Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MYM4

Protein Details
Accession M2MYM4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-86NPSHRVRKRRHGFLARLRSRTGRMVLKRRRAKGRNTLSHBasic
NLS Segment(s)
PositionSequence
50-81SHRVRKRRHGFLARLRSRTGRMVLKRRRAKGR
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG bcom:BAUCODRAFT_80460  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences IRPTFRAQPSTAPSPISADTPSPSSFQPLSSLLTSLLQVRGAKRDTFNPSHRVRKRRHGFLARLRSRTGRMVLKRRRAKGRNTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.22
5 0.17
6 0.17
7 0.19
8 0.19
9 0.18
10 0.17
11 0.19
12 0.18
13 0.17
14 0.18
15 0.16
16 0.18
17 0.17
18 0.17
19 0.13
20 0.13
21 0.13
22 0.11
23 0.1
24 0.1
25 0.1
26 0.1
27 0.14
28 0.15
29 0.16
30 0.16
31 0.21
32 0.25
33 0.3
34 0.34
35 0.37
36 0.41
37 0.5
38 0.57
39 0.6
40 0.59
41 0.64
42 0.69
43 0.71
44 0.75
45 0.74
46 0.75
47 0.77
48 0.83
49 0.79
50 0.73
51 0.66
52 0.59
53 0.54
54 0.5
55 0.46
56 0.44
57 0.46
58 0.54
59 0.61
60 0.69
61 0.75
62 0.79
63 0.84
64 0.82
65 0.82
66 0.82