Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MDP4

Protein Details
Accession M2MDP4    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21QQQQHPRRTSLPRNQKPPALPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
KEGG bcom:BAUCODRAFT_48014  -  
Pfam View protein in Pfam  
PF08613  Cyclin  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences QQQQHPRRTSLPRNQKPPALPRQCERKSFFVDHLVDTVTQMVEVIWPLSIVPCRNDSATGRGVLPLRRYVEETLRRSRTSYSTLQVALYYLVLIKPFVPRTDFTMEQEFDCPAERALMCGRRMFLAALILASKYLQDRNYSAKAWSKMSGLPVPEININERTFLSKIQWKLHVPQPTYTRWAKIVVEYTLHTQPPSPGSGNCTVAWRRIIPLLTPELDKVPLPIEQAVSVPECPAGFSLTPPVTPTETTSAMNALQLDLTLQESKPTPMSAPPPFMEPSANIAPPTPNLLRQGPLDTPSMTPSTVGVNTPTAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.79
4 0.78
5 0.78
6 0.77
7 0.72
8 0.71
9 0.76
10 0.75
11 0.76
12 0.71
13 0.68
14 0.65
15 0.65
16 0.6
17 0.58
18 0.54
19 0.47
20 0.43
21 0.37
22 0.29
23 0.25
24 0.22
25 0.13
26 0.1
27 0.09
28 0.07
29 0.06
30 0.07
31 0.07
32 0.05
33 0.05
34 0.05
35 0.08
36 0.11
37 0.12
38 0.14
39 0.16
40 0.18
41 0.19
42 0.23
43 0.23
44 0.25
45 0.26
46 0.25
47 0.23
48 0.24
49 0.27
50 0.27
51 0.27
52 0.28
53 0.28
54 0.27
55 0.3
56 0.3
57 0.37
58 0.42
59 0.45
60 0.49
61 0.51
62 0.5
63 0.49
64 0.49
65 0.44
66 0.41
67 0.39
68 0.33
69 0.31
70 0.31
71 0.3
72 0.27
73 0.23
74 0.17
75 0.13
76 0.1
77 0.07
78 0.06
79 0.06
80 0.06
81 0.07
82 0.1
83 0.12
84 0.13
85 0.15
86 0.16
87 0.21
88 0.27
89 0.27
90 0.26
91 0.31
92 0.3
93 0.28
94 0.29
95 0.23
96 0.18
97 0.18
98 0.16
99 0.09
100 0.11
101 0.1
102 0.11
103 0.15
104 0.2
105 0.2
106 0.2
107 0.21
108 0.18
109 0.19
110 0.18
111 0.13
112 0.1
113 0.08
114 0.07
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.08
122 0.09
123 0.1
124 0.13
125 0.18
126 0.21
127 0.21
128 0.22
129 0.26
130 0.27
131 0.27
132 0.26
133 0.22
134 0.21
135 0.23
136 0.23
137 0.18
138 0.17
139 0.15
140 0.15
141 0.15
142 0.14
143 0.13
144 0.14
145 0.13
146 0.13
147 0.13
148 0.14
149 0.14
150 0.14
151 0.15
152 0.16
153 0.19
154 0.22
155 0.26
156 0.26
157 0.29
158 0.34
159 0.38
160 0.35
161 0.37
162 0.37
163 0.35
164 0.39
165 0.36
166 0.32
167 0.26
168 0.27
169 0.23
170 0.21
171 0.22
172 0.18
173 0.18
174 0.17
175 0.2
176 0.2
177 0.19
178 0.17
179 0.15
180 0.15
181 0.16
182 0.18
183 0.15
184 0.13
185 0.17
186 0.21
187 0.23
188 0.22
189 0.25
190 0.23
191 0.24
192 0.25
193 0.21
194 0.19
195 0.2
196 0.2
197 0.16
198 0.19
199 0.19
200 0.18
201 0.19
202 0.18
203 0.16
204 0.16
205 0.16
206 0.13
207 0.11
208 0.11
209 0.12
210 0.12
211 0.11
212 0.11
213 0.12
214 0.12
215 0.12
216 0.11
217 0.1
218 0.1
219 0.09
220 0.09
221 0.09
222 0.1
223 0.09
224 0.09
225 0.15
226 0.15
227 0.15
228 0.16
229 0.18
230 0.17
231 0.18
232 0.2
233 0.18
234 0.2
235 0.2
236 0.2
237 0.19
238 0.17
239 0.18
240 0.15
241 0.11
242 0.09
243 0.08
244 0.07
245 0.06
246 0.09
247 0.09
248 0.09
249 0.11
250 0.13
251 0.15
252 0.16
253 0.17
254 0.16
255 0.19
256 0.26
257 0.28
258 0.32
259 0.31
260 0.33
261 0.33
262 0.33
263 0.3
264 0.24
265 0.26
266 0.26
267 0.26
268 0.23
269 0.23
270 0.24
271 0.23
272 0.28
273 0.23
274 0.22
275 0.26
276 0.28
277 0.3
278 0.3
279 0.34
280 0.3
281 0.31
282 0.3
283 0.26
284 0.25
285 0.26
286 0.26
287 0.21
288 0.18
289 0.17
290 0.19
291 0.18
292 0.18
293 0.17