Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2M0N5

Protein Details
Accession M2M0N5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPPKRSSQTGSKRAKKPKIKPSVSILHydrophilic
NLS Segment(s)
PositionSequence
10-20GSKRAKKPKIK
Subcellular Location(s) mito 15.5, mito_nucl 12.333, nucl 8, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
KEGG bcom:BAUCODRAFT_173923  -  
Pfam View protein in Pfam  
PF12937  F-box-like  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MPPKRSSQTGSKRAKKPKIKPSVSILSLPAELHLLLISHLPSRKDLKRLCLTCKSLSAVATSVLYRHVVLKLCRLRTHLERTFNEKNAGLLHVRHLTITDLHREYEDNRHGCTLTEVLRALPRDVLLSCSLETSKLVGTEVSFMLRIRQRQLTNCELHAIKTVPPIDCIPDRDELRNVTSLSLYLASRHDRQRAAAVLLAASNTQNLALTIPDDGLRKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.89
5 0.89
6 0.85
7 0.81
8 0.79
9 0.78
10 0.7
11 0.62
12 0.53
13 0.44
14 0.39
15 0.33
16 0.25
17 0.16
18 0.13
19 0.11
20 0.09
21 0.07
22 0.06
23 0.07
24 0.08
25 0.11
26 0.14
27 0.14
28 0.18
29 0.25
30 0.3
31 0.37
32 0.4
33 0.46
34 0.53
35 0.57
36 0.61
37 0.62
38 0.62
39 0.56
40 0.55
41 0.49
42 0.41
43 0.37
44 0.31
45 0.22
46 0.18
47 0.17
48 0.13
49 0.11
50 0.1
51 0.1
52 0.09
53 0.1
54 0.12
55 0.15
56 0.16
57 0.25
58 0.3
59 0.33
60 0.34
61 0.35
62 0.38
63 0.4
64 0.48
65 0.45
66 0.48
67 0.46
68 0.53
69 0.56
70 0.53
71 0.49
72 0.4
73 0.34
74 0.27
75 0.26
76 0.19
77 0.14
78 0.14
79 0.14
80 0.14
81 0.13
82 0.13
83 0.12
84 0.14
85 0.14
86 0.16
87 0.15
88 0.15
89 0.16
90 0.16
91 0.17
92 0.21
93 0.26
94 0.22
95 0.22
96 0.23
97 0.23
98 0.22
99 0.21
100 0.16
101 0.11
102 0.12
103 0.11
104 0.11
105 0.13
106 0.14
107 0.13
108 0.12
109 0.1
110 0.1
111 0.1
112 0.11
113 0.1
114 0.1
115 0.1
116 0.1
117 0.1
118 0.1
119 0.1
120 0.09
121 0.08
122 0.07
123 0.07
124 0.06
125 0.07
126 0.08
127 0.08
128 0.08
129 0.08
130 0.08
131 0.13
132 0.16
133 0.18
134 0.2
135 0.26
136 0.29
137 0.34
138 0.4
139 0.42
140 0.42
141 0.4
142 0.41
143 0.34
144 0.32
145 0.3
146 0.25
147 0.19
148 0.22
149 0.24
150 0.2
151 0.22
152 0.22
153 0.23
154 0.24
155 0.26
156 0.23
157 0.27
158 0.29
159 0.3
160 0.32
161 0.3
162 0.3
163 0.31
164 0.29
165 0.23
166 0.21
167 0.18
168 0.17
169 0.16
170 0.13
171 0.11
172 0.15
173 0.19
174 0.25
175 0.3
176 0.34
177 0.34
178 0.36
179 0.41
180 0.4
181 0.38
182 0.34
183 0.29
184 0.24
185 0.22
186 0.21
187 0.15
188 0.12
189 0.1
190 0.07
191 0.07
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.09
199 0.11