Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S8D1

Protein Details
Accession F4S8D1    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
136-164DMKRNECSSKPQKTTPKKTRRSPDLRLSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, mito_nucl 11.999, cyto_mito 9.499, nucl 8.5, cyto_nucl 7.166
Family & Domain DBs
KEGG mlr:MELLADRAFT_68840  -  
Amino Acid Sequences MFYNRILISLSLISLFQQTVMGQCLPLRGAAPIDIEQCRKALATYKFEDNSALDSDGYKNKKTCGNCAISMSRVSTDPKVKPSLDGYDKKFLEETVATLSQKCTIKGTKGMLPSIFVGTTVPADGTYFAIEIEVGDMKRNECSSKPQKTTPKKTRRSPDLRLSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.08
5 0.08
6 0.09
7 0.12
8 0.12
9 0.11
10 0.12
11 0.13
12 0.12
13 0.12
14 0.11
15 0.09
16 0.1
17 0.1
18 0.12
19 0.13
20 0.16
21 0.18
22 0.2
23 0.19
24 0.19
25 0.18
26 0.16
27 0.14
28 0.19
29 0.22
30 0.27
31 0.29
32 0.35
33 0.35
34 0.35
35 0.35
36 0.28
37 0.24
38 0.2
39 0.18
40 0.12
41 0.12
42 0.14
43 0.19
44 0.21
45 0.22
46 0.21
47 0.23
48 0.28
49 0.29
50 0.33
51 0.34
52 0.36
53 0.34
54 0.37
55 0.36
56 0.32
57 0.31
58 0.26
59 0.19
60 0.16
61 0.16
62 0.16
63 0.2
64 0.2
65 0.23
66 0.26
67 0.25
68 0.25
69 0.26
70 0.28
71 0.29
72 0.33
73 0.33
74 0.38
75 0.38
76 0.37
77 0.35
78 0.28
79 0.24
80 0.19
81 0.16
82 0.12
83 0.14
84 0.14
85 0.14
86 0.14
87 0.17
88 0.18
89 0.18
90 0.17
91 0.18
92 0.21
93 0.25
94 0.28
95 0.27
96 0.28
97 0.3
98 0.27
99 0.26
100 0.24
101 0.21
102 0.17
103 0.13
104 0.1
105 0.09
106 0.09
107 0.07
108 0.06
109 0.05
110 0.06
111 0.06
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.05
119 0.06
120 0.08
121 0.08
122 0.1
123 0.12
124 0.12
125 0.16
126 0.18
127 0.19
128 0.19
129 0.29
130 0.37
131 0.46
132 0.51
133 0.57
134 0.67
135 0.75
136 0.84
137 0.85
138 0.86
139 0.86
140 0.9
141 0.92
142 0.92
143 0.9
144 0.88