Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2LKT0

Protein Details
Accession M2LKT0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-44VQGWHPTRKQREMKDKDMRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
IPR039949  NAA40  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043998  F:histone H2A acetyltransferase activity  
GO:0010485  F:histone H4 acetyltransferase activity  
KEGG bcom:BAUCODRAFT_45698  -  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
Amino Acid Sequences LYDREISECYDLVSITSQADYEASVQGWHPTRKQREMKDKDMRYLLVRTVSSKEDVGIDLDTTVDGFLSFMLTHDSTPAVPVLYIYELHLAGQLRKLGLGSHLLSLAENIAERVGVKKVMLTCFLSNTKAHTFYLKHGYAKDVSSPDDRRTRNGISKPDYVIMSKTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.09
5 0.09
6 0.09
7 0.09
8 0.08
9 0.09
10 0.08
11 0.09
12 0.09
13 0.15
14 0.2
15 0.23
16 0.27
17 0.35
18 0.42
19 0.52
20 0.6
21 0.64
22 0.7
23 0.75
24 0.8
25 0.81
26 0.77
27 0.73
28 0.67
29 0.59
30 0.51
31 0.45
32 0.37
33 0.3
34 0.27
35 0.24
36 0.23
37 0.23
38 0.21
39 0.19
40 0.18
41 0.14
42 0.14
43 0.13
44 0.1
45 0.09
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.08
77 0.08
78 0.08
79 0.1
80 0.1
81 0.09
82 0.09
83 0.09
84 0.07
85 0.08
86 0.11
87 0.1
88 0.09
89 0.1
90 0.1
91 0.1
92 0.1
93 0.09
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.06
101 0.07
102 0.07
103 0.07
104 0.1
105 0.13
106 0.15
107 0.17
108 0.19
109 0.19
110 0.22
111 0.24
112 0.24
113 0.22
114 0.25
115 0.26
116 0.24
117 0.24
118 0.25
119 0.25
120 0.28
121 0.36
122 0.35
123 0.34
124 0.32
125 0.36
126 0.33
127 0.33
128 0.33
129 0.26
130 0.26
131 0.32
132 0.34
133 0.37
134 0.44
135 0.44
136 0.44
137 0.48
138 0.52
139 0.54
140 0.58
141 0.6
142 0.58
143 0.61
144 0.59
145 0.57
146 0.51
147 0.44