Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2LTU1

Protein Details
Accession M2LTU1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-89CLLEYPSTRERRRRRRREKEHYAAESRBasic
NLS Segment(s)
PositionSequence
71-103RERRRRRRREKEHYAAESRPYERRRSRSANSRP
Subcellular Location(s) plas 15, nucl 4, E.R. 3, extr 2, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
KEGG bcom:BAUCODRAFT_31964  -  
Pfam View protein in Pfam  
PF01679  Pmp3  
PROSITE View protein in PROSITE  
PS01309  UPF0057  
Amino Acid Sequences MAKQRSSEHCLTYEQGSIILGVTAIVFPPLAVLFRAGCGVHFILNIGLLFLGWIPAILHAWWCLLEYPSTRERRRRRRREKEHYAAESRPYERRRSRSANSRPSSSSKHRSHSSGHQSSAPAYRDSYAGRYVSADPYYRQEMAYSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.18
4 0.16
5 0.13
6 0.1
7 0.07
8 0.05
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.05
18 0.05
19 0.07
20 0.07
21 0.07
22 0.09
23 0.08
24 0.08
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.08
31 0.09
32 0.09
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.12
55 0.19
56 0.26
57 0.29
58 0.38
59 0.48
60 0.58
61 0.68
62 0.75
63 0.8
64 0.85
65 0.92
66 0.94
67 0.95
68 0.93
69 0.9
70 0.84
71 0.77
72 0.67
73 0.6
74 0.53
75 0.44
76 0.42
77 0.36
78 0.39
79 0.42
80 0.46
81 0.5
82 0.54
83 0.59
84 0.63
85 0.7
86 0.72
87 0.69
88 0.67
89 0.63
90 0.6
91 0.6
92 0.58
93 0.58
94 0.53
95 0.56
96 0.56
97 0.55
98 0.55
99 0.58
100 0.6
101 0.55
102 0.52
103 0.47
104 0.45
105 0.44
106 0.46
107 0.38
108 0.28
109 0.24
110 0.23
111 0.22
112 0.23
113 0.24
114 0.21
115 0.2
116 0.19
117 0.2
118 0.21
119 0.24
120 0.25
121 0.24
122 0.22
123 0.27
124 0.31
125 0.29
126 0.28
127 0.25
128 0.29