Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2M9T9

Protein Details
Accession M2M9T9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-56CINCGQRPGRRRRGLCKSRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
KEGG bcom:BAUCODRAFT_231413  -  
Amino Acid Sequences MLLSLMAHSRHFQPGCPSFRPSSEEKPCDALKTDWACINCGQRPGRRRRGLCKSRVMALISAARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.44
4 0.46
5 0.39
6 0.41
7 0.43
8 0.4
9 0.42
10 0.45
11 0.44
12 0.41
13 0.43
14 0.41
15 0.39
16 0.36
17 0.26
18 0.24
19 0.24
20 0.24
21 0.22
22 0.22
23 0.22
24 0.22
25 0.26
26 0.21
27 0.25
28 0.29
29 0.32
30 0.41
31 0.5
32 0.58
33 0.63
34 0.66
35 0.7
36 0.77
37 0.81
38 0.8
39 0.8
40 0.73
41 0.69
42 0.67
43 0.6
44 0.49
45 0.44