Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MHZ8

Protein Details
Accession M2MHZ8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
158-184FIYVHCWCFTRRQRRRRAPVTRSACAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_330923  -  
Amino Acid Sequences MVSVGLRCTVCADSFRPYQPTNTARVVKHPRAWDKASEQISFSDVGNKSNIPEPLPPRFPKPPTFEHPLSPPSSMSSSPSPSLPPIPPTSATSPISPISSSAPPAPPSPSSPPAPSPHPLHMSHPSAASPCSAHHVQHKSLSPKPTQLNSHASQPRTFIYVHCWCFTRRQRRRRAPVTRSACAPTASRFTLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.34
4 0.34
5 0.36
6 0.41
7 0.42
8 0.42
9 0.45
10 0.47
11 0.42
12 0.51
13 0.57
14 0.56
15 0.59
16 0.62
17 0.62
18 0.63
19 0.65
20 0.61
21 0.56
22 0.57
23 0.55
24 0.47
25 0.4
26 0.34
27 0.32
28 0.27
29 0.22
30 0.22
31 0.18
32 0.18
33 0.19
34 0.18
35 0.18
36 0.22
37 0.23
38 0.17
39 0.23
40 0.26
41 0.31
42 0.38
43 0.38
44 0.4
45 0.46
46 0.48
47 0.5
48 0.51
49 0.51
50 0.5
51 0.56
52 0.52
53 0.47
54 0.47
55 0.43
56 0.39
57 0.33
58 0.28
59 0.22
60 0.22
61 0.19
62 0.19
63 0.18
64 0.18
65 0.18
66 0.18
67 0.17
68 0.16
69 0.19
70 0.17
71 0.17
72 0.17
73 0.18
74 0.19
75 0.21
76 0.22
77 0.24
78 0.24
79 0.21
80 0.21
81 0.2
82 0.19
83 0.16
84 0.14
85 0.12
86 0.11
87 0.12
88 0.12
89 0.13
90 0.14
91 0.15
92 0.16
93 0.15
94 0.18
95 0.22
96 0.24
97 0.25
98 0.26
99 0.28
100 0.29
101 0.31
102 0.32
103 0.3
104 0.31
105 0.33
106 0.32
107 0.33
108 0.36
109 0.36
110 0.33
111 0.3
112 0.26
113 0.22
114 0.22
115 0.18
116 0.12
117 0.09
118 0.14
119 0.15
120 0.16
121 0.23
122 0.27
123 0.29
124 0.34
125 0.4
126 0.4
127 0.45
128 0.48
129 0.43
130 0.45
131 0.48
132 0.48
133 0.46
134 0.46
135 0.48
136 0.44
137 0.52
138 0.5
139 0.47
140 0.42
141 0.4
142 0.36
143 0.31
144 0.29
145 0.2
146 0.23
147 0.29
148 0.31
149 0.31
150 0.32
151 0.31
152 0.41
153 0.5
154 0.53
155 0.55
156 0.63
157 0.72
158 0.82
159 0.91
160 0.92
161 0.93
162 0.9
163 0.9
164 0.88
165 0.81
166 0.74
167 0.67
168 0.59
169 0.5
170 0.44
171 0.38
172 0.36
173 0.35