Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NI30

Protein Details
Accession M2NI30    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-101LENQLKAEKRGKKKTGRRLAPSPCPLHydrophilic
NLS Segment(s)
PositionSequence
82-93AEKRGKKKTGRR
Subcellular Location(s) mito 11, extr 9, cyto 3, pero 2
Family & Domain DBs
KEGG bcom:BAUCODRAFT_387133  -  
Amino Acid Sequences MLPRTAEDAPTGRPIPILVLVTHLYRSSRAKARVLQRSLFVSPPLWLLGVEHFLVTLYCFAFPYRFALAVEVRDILENQLKAEKRGKKKTGRRLAPSPCPLPTVLFNGGNRPIQPRALPTIDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.19
5 0.12
6 0.15
7 0.16
8 0.16
9 0.17
10 0.16
11 0.14
12 0.16
13 0.19
14 0.23
15 0.29
16 0.33
17 0.37
18 0.43
19 0.51
20 0.57
21 0.58
22 0.53
23 0.48
24 0.48
25 0.45
26 0.39
27 0.31
28 0.22
29 0.18
30 0.17
31 0.14
32 0.1
33 0.08
34 0.08
35 0.08
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.06
50 0.09
51 0.09
52 0.09
53 0.09
54 0.11
55 0.12
56 0.12
57 0.12
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.11
64 0.11
65 0.11
66 0.16
67 0.16
68 0.19
69 0.27
70 0.34
71 0.4
72 0.5
73 0.59
74 0.64
75 0.73
76 0.81
77 0.84
78 0.85
79 0.83
80 0.82
81 0.82
82 0.82
83 0.79
84 0.71
85 0.62
86 0.54
87 0.47
88 0.4
89 0.35
90 0.3
91 0.28
92 0.29
93 0.28
94 0.31
95 0.34
96 0.34
97 0.33
98 0.32
99 0.3
100 0.29
101 0.31
102 0.3
103 0.33