Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2LN72

Protein Details
Accession M2LN72   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-103SEEGRRRRPKPPRVTKLGRSKLVBasic
NLS Segment(s)
PositionSequence
67-99RGLGKRRGASKKAASEEGRRRRPKPPRVTKLGR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 3
Family & Domain DBs
KEGG bcom:BAUCODRAFT_148669  -  
Amino Acid Sequences MPIGEGNKTPWSESEMMIDQLGTVDWDGIDLPKDRTLTGAIKMIAKAKAKLAADVSGSVGGNGVSARGLGKRRGASKKAASEEGRRRRPKPPRVTKLGRSKLVWMSWRLIALTTTRGIQTVSKTWQSRESRGMMMASSPEQAMAADVVPTPISCHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.24
4 0.23
5 0.22
6 0.15
7 0.14
8 0.13
9 0.08
10 0.06
11 0.05
12 0.04
13 0.05
14 0.05
15 0.06
16 0.08
17 0.09
18 0.11
19 0.14
20 0.15
21 0.15
22 0.16
23 0.19
24 0.19
25 0.19
26 0.21
27 0.19
28 0.2
29 0.21
30 0.24
31 0.25
32 0.25
33 0.23
34 0.21
35 0.26
36 0.24
37 0.25
38 0.23
39 0.2
40 0.18
41 0.18
42 0.16
43 0.12
44 0.12
45 0.1
46 0.08
47 0.06
48 0.06
49 0.05
50 0.05
51 0.03
52 0.03
53 0.04
54 0.07
55 0.09
56 0.11
57 0.15
58 0.18
59 0.25
60 0.32
61 0.34
62 0.37
63 0.41
64 0.45
65 0.43
66 0.45
67 0.41
68 0.43
69 0.51
70 0.54
71 0.58
72 0.58
73 0.59
74 0.63
75 0.71
76 0.73
77 0.74
78 0.76
79 0.74
80 0.78
81 0.82
82 0.82
83 0.83
84 0.8
85 0.73
86 0.63
87 0.59
88 0.54
89 0.5
90 0.45
91 0.36
92 0.31
93 0.28
94 0.27
95 0.23
96 0.19
97 0.16
98 0.14
99 0.14
100 0.12
101 0.12
102 0.11
103 0.11
104 0.12
105 0.13
106 0.15
107 0.18
108 0.22
109 0.28
110 0.3
111 0.32
112 0.4
113 0.43
114 0.45
115 0.46
116 0.45
117 0.39
118 0.39
119 0.38
120 0.29
121 0.25
122 0.22
123 0.18
124 0.15
125 0.13
126 0.11
127 0.1
128 0.1
129 0.1
130 0.08
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.08