Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N510

Protein Details
Accession M2N510    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-29PAFPKLVLSKHVRRRKRCSKTISIWLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_212346  -  
Amino Acid Sequences MYPAFPKLVLSKHVRRRKRCSKTISIWLTLAVCSKSNRHRYPAGDSPVTCTLSYVACNASSSHESKPTRAAYPASCRAKGSACAVRLGKGCRRCQKQVGKYLQLAEDTFCDHDTFRRDCPSPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.8
4 0.85
5 0.87
6 0.87
7 0.86
8 0.86
9 0.84
10 0.85
11 0.8
12 0.71
13 0.61
14 0.53
15 0.44
16 0.34
17 0.29
18 0.19
19 0.16
20 0.15
21 0.2
22 0.28
23 0.37
24 0.4
25 0.42
26 0.47
27 0.48
28 0.54
29 0.56
30 0.53
31 0.46
32 0.43
33 0.42
34 0.41
35 0.39
36 0.31
37 0.23
38 0.18
39 0.16
40 0.16
41 0.12
42 0.09
43 0.07
44 0.08
45 0.08
46 0.1
47 0.11
48 0.13
49 0.13
50 0.2
51 0.21
52 0.21
53 0.26
54 0.26
55 0.25
56 0.25
57 0.26
58 0.23
59 0.29
60 0.38
61 0.36
62 0.35
63 0.34
64 0.34
65 0.33
66 0.32
67 0.3
68 0.27
69 0.23
70 0.27
71 0.27
72 0.29
73 0.31
74 0.33
75 0.34
76 0.36
77 0.44
78 0.49
79 0.56
80 0.59
81 0.65
82 0.71
83 0.73
84 0.76
85 0.76
86 0.72
87 0.68
88 0.65
89 0.58
90 0.49
91 0.41
92 0.32
93 0.24
94 0.2
95 0.18
96 0.16
97 0.15
98 0.13
99 0.17
100 0.23
101 0.25
102 0.27
103 0.34
104 0.36