Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2LD86

Protein Details
Accession M2LD86    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
191-210KAGRGGKKRSGRAGRPKAKTBasic
NLS Segment(s)
PositionSequence
19-37KGGRRGRRVPARRAAGAKP
161-209AKPKNASKESAKAAAAPKKDAAKPAADAAAKAGRGGKKRSGRAGRPKAK
Subcellular Location(s) mito 14, cyto 6.5, cyto_nucl 6.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG bcom:BAUCODRAFT_152279  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MSGKLDQSLDTIMAEGGNKGGRRGRRVPARRAAGAKPAVAAPTGGVQKTTRAPRTTASAPTAPASGDSKIIVSNLPQDITELLLKDFFAKAVGSVKKVLLSYGPNGRSRGEATVIFSKPNAAAEAMKQFNNVKVDNRPMKIEIVGSSIAAPAKQTMADRMAKPKNASKESAKAAAAPKKDAAKPAADAAAKAGRGGKKRSGRAGRPKAKTADELDAEMADYFGGGEGAPNGAAATNGAVQPAATNGNDAAMDEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.13
5 0.13
6 0.15
7 0.21
8 0.26
9 0.34
10 0.4
11 0.48
12 0.55
13 0.63
14 0.7
15 0.74
16 0.75
17 0.73
18 0.72
19 0.65
20 0.63
21 0.57
22 0.48
23 0.39
24 0.33
25 0.28
26 0.23
27 0.2
28 0.12
29 0.14
30 0.16
31 0.15
32 0.15
33 0.15
34 0.18
35 0.25
36 0.33
37 0.34
38 0.34
39 0.36
40 0.36
41 0.43
42 0.44
43 0.41
44 0.38
45 0.33
46 0.32
47 0.31
48 0.29
49 0.22
50 0.2
51 0.18
52 0.13
53 0.13
54 0.12
55 0.11
56 0.11
57 0.11
58 0.1
59 0.08
60 0.12
61 0.12
62 0.13
63 0.12
64 0.12
65 0.12
66 0.13
67 0.14
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.07
75 0.07
76 0.06
77 0.07
78 0.14
79 0.15
80 0.15
81 0.17
82 0.17
83 0.18
84 0.18
85 0.17
86 0.13
87 0.13
88 0.15
89 0.21
90 0.24
91 0.24
92 0.26
93 0.26
94 0.25
95 0.24
96 0.23
97 0.18
98 0.15
99 0.16
100 0.21
101 0.21
102 0.19
103 0.18
104 0.17
105 0.15
106 0.15
107 0.13
108 0.07
109 0.07
110 0.08
111 0.14
112 0.14
113 0.14
114 0.15
115 0.15
116 0.17
117 0.19
118 0.19
119 0.16
120 0.18
121 0.25
122 0.29
123 0.3
124 0.29
125 0.27
126 0.27
127 0.25
128 0.23
129 0.15
130 0.13
131 0.12
132 0.1
133 0.09
134 0.09
135 0.09
136 0.08
137 0.07
138 0.05
139 0.05
140 0.06
141 0.07
142 0.08
143 0.12
144 0.16
145 0.18
146 0.26
147 0.3
148 0.32
149 0.34
150 0.37
151 0.42
152 0.41
153 0.44
154 0.4
155 0.42
156 0.43
157 0.44
158 0.38
159 0.33
160 0.36
161 0.38
162 0.35
163 0.3
164 0.3
165 0.32
166 0.33
167 0.33
168 0.29
169 0.26
170 0.26
171 0.26
172 0.28
173 0.22
174 0.21
175 0.2
176 0.21
177 0.19
178 0.18
179 0.21
180 0.21
181 0.26
182 0.3
183 0.36
184 0.41
185 0.47
186 0.57
187 0.61
188 0.66
189 0.73
190 0.79
191 0.8
192 0.78
193 0.79
194 0.74
195 0.68
196 0.63
197 0.56
198 0.52
199 0.44
200 0.39
201 0.33
202 0.28
203 0.25
204 0.2
205 0.15
206 0.08
207 0.06
208 0.05
209 0.04
210 0.04
211 0.03
212 0.04
213 0.04
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.06
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.09
228 0.1
229 0.11
230 0.09
231 0.11
232 0.11
233 0.12
234 0.12
235 0.12