Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MWD4

Protein Details
Accession M2MWD4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-64WPIRKLRKTLLEHKHCRRILBasic
NLS Segment(s)
PositionSequence
42-50RRGWPIRKL
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
KEGG bcom:BAUCODRAFT_39706  -  
Amino Acid Sequences MEVPLLQQRPKKDAHTVELLTKLYQVLQRSVLRGRLQGERTRRGWPIRKLRKTLLEHKHCRRILVPSNSSAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.47
4 0.45
5 0.45
6 0.41
7 0.32
8 0.27
9 0.22
10 0.17
11 0.18
12 0.16
13 0.14
14 0.18
15 0.19
16 0.21
17 0.23
18 0.26
19 0.24
20 0.25
21 0.26
22 0.26
23 0.28
24 0.31
25 0.35
26 0.36
27 0.37
28 0.38
29 0.4
30 0.42
31 0.48
32 0.52
33 0.57
34 0.63
35 0.68
36 0.7
37 0.72
38 0.74
39 0.72
40 0.73
41 0.73
42 0.73
43 0.75
44 0.78
45 0.82
46 0.74
47 0.7
48 0.63
49 0.61
50 0.61
51 0.61
52 0.56
53 0.49