Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N4W8

Protein Details
Accession M2N4W8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-115QTMAKERRERAERRKRAEGYBasic
NLS Segment(s)
PositionSequence
100-111KERRERAERRKR
Subcellular Location(s) mito 15.5, cyto_mito 11.5, cyto 6.5, nucl 4
Family & Domain DBs
KEGG bcom:BAUCODRAFT_219815  -  
Amino Acid Sequences MAVNAAHQINITSELYRRKSYLWHGDLRLAGNGTPGKAEPTRAFLRPTPKDYDGMDIFERCRQDFLVAQRALGWAQVLEVERCRIRGEERTARIMQTMAKERRERAERRKRAEGYSGAGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.31
4 0.3
5 0.28
6 0.33
7 0.4
8 0.46
9 0.44
10 0.46
11 0.46
12 0.48
13 0.49
14 0.44
15 0.38
16 0.28
17 0.22
18 0.19
19 0.18
20 0.15
21 0.14
22 0.12
23 0.14
24 0.14
25 0.18
26 0.15
27 0.2
28 0.23
29 0.24
30 0.27
31 0.26
32 0.35
33 0.37
34 0.4
35 0.4
36 0.38
37 0.38
38 0.36
39 0.38
40 0.29
41 0.27
42 0.24
43 0.19
44 0.18
45 0.18
46 0.18
47 0.13
48 0.13
49 0.11
50 0.11
51 0.14
52 0.17
53 0.24
54 0.23
55 0.23
56 0.22
57 0.23
58 0.21
59 0.18
60 0.14
61 0.04
62 0.04
63 0.06
64 0.07
65 0.07
66 0.08
67 0.11
68 0.12
69 0.13
70 0.14
71 0.13
72 0.16
73 0.23
74 0.31
75 0.37
76 0.4
77 0.46
78 0.46
79 0.45
80 0.42
81 0.35
82 0.29
83 0.27
84 0.34
85 0.33
86 0.4
87 0.43
88 0.45
89 0.54
90 0.59
91 0.62
92 0.63
93 0.69
94 0.71
95 0.76
96 0.83
97 0.78
98 0.75
99 0.74
100 0.67
101 0.61