Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MVE1

Protein Details
Accession M2MVE1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-70FTPPPAPARKPRRERKSHASHDGWBasic
NLS Segment(s)
PositionSequence
34-34K
50-63PPAPARKPRRERKS
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_29319  -  
Amino Acid Sequences MPTQQVLYVNGVKQRGGKHVYFDGIEQPASKPKKVTKPLKGILKNCFTPPPAPARKPRRERKSHASHDGWYEYEHTTRKESRNGRPYYTTRSTYRRWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.31
5 0.32
6 0.34
7 0.35
8 0.32
9 0.3
10 0.27
11 0.23
12 0.22
13 0.18
14 0.16
15 0.22
16 0.24
17 0.25
18 0.24
19 0.3
20 0.4
21 0.49
22 0.58
23 0.59
24 0.65
25 0.71
26 0.77
27 0.76
28 0.71
29 0.67
30 0.63
31 0.55
32 0.47
33 0.42
34 0.34
35 0.28
36 0.25
37 0.28
38 0.29
39 0.31
40 0.4
41 0.48
42 0.56
43 0.65
44 0.74
45 0.75
46 0.78
47 0.82
48 0.83
49 0.84
50 0.82
51 0.81
52 0.74
53 0.65
54 0.61
55 0.55
56 0.45
57 0.35
58 0.29
59 0.21
60 0.22
61 0.23
62 0.2
63 0.24
64 0.3
65 0.34
66 0.41
67 0.47
68 0.54
69 0.61
70 0.64
71 0.64
72 0.65
73 0.65
74 0.65
75 0.65
76 0.6
77 0.57
78 0.59