Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MAC6

Protein Details
Accession M2MAC6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MFKRPVQKPQRRTRHVNYRAVAHydrophilic
97-124DMGKCCTKLLRWPKRTQRRERSDACNWKHydrophilic
NLS Segment(s)
PositionSequence
36-58RRNKRPLSGRGAKSGSSTRRNRG
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_240081  -  
Amino Acid Sequences MFKRPVQKPQRRTRHVNYRAVAIDERLVSDAEISGRRNKRPLSGRGAKSGSSTRRNRGLTGRRQGCTREPWRYAKKLTGCETRADWQFSDPGRLVPDMGKCCTKLLRWPKRTQRRERSDACNWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.85
4 0.76
5 0.71
6 0.64
7 0.58
8 0.49
9 0.38
10 0.32
11 0.23
12 0.22
13 0.16
14 0.15
15 0.11
16 0.1
17 0.1
18 0.09
19 0.11
20 0.13
21 0.2
22 0.25
23 0.28
24 0.33
25 0.34
26 0.4
27 0.45
28 0.49
29 0.51
30 0.56
31 0.56
32 0.57
33 0.57
34 0.49
35 0.44
36 0.44
37 0.41
38 0.4
39 0.42
40 0.4
41 0.46
42 0.47
43 0.46
44 0.49
45 0.51
46 0.51
47 0.57
48 0.57
49 0.5
50 0.51
51 0.51
52 0.46
53 0.46
54 0.43
55 0.4
56 0.4
57 0.47
58 0.53
59 0.55
60 0.54
61 0.52
62 0.51
63 0.5
64 0.52
65 0.52
66 0.47
67 0.44
68 0.45
69 0.43
70 0.41
71 0.37
72 0.31
73 0.24
74 0.27
75 0.25
76 0.27
77 0.22
78 0.2
79 0.19
80 0.19
81 0.19
82 0.17
83 0.23
84 0.22
85 0.25
86 0.26
87 0.25
88 0.27
89 0.29
90 0.28
91 0.32
92 0.4
93 0.48
94 0.54
95 0.64
96 0.73
97 0.81
98 0.89
99 0.91
100 0.91
101 0.9
102 0.91
103 0.88
104 0.85