Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2NIH6

Protein Details
Accession M2NIH6   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-109ATPPLDRPHRDKRRRHHAPSGGSBasic
NLS Segment(s)
PositionSequence
96-101RDKRRR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_31170  -  
Amino Acid Sequences MPPSDTATQNTPLAPSVEKAYYRKCIELKRRLNEVEAANDEMKIRRVRLDRAITKMRLERAFLLEQLSKRMHGDIDGSEGSADEGMATPPLDRPHRDKRRRHHAPSGGSIVPPQQPVPIAAYPGPASAPPLQPRLLPLDPSAAAGSPPLVPGPGGVMVPANAVNQDGQYIYLPSTDHPLQHPAALPPPPLGHLPSQHESPYGPPTGVPTTARAHLNGTSTEEHEPQPNINRSEAATGEALTAGPTIREEASGERRIVADSTPAAAETDRMDTSGSGGAGAGFTAVNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.19
4 0.22
5 0.26
6 0.29
7 0.33
8 0.4
9 0.42
10 0.47
11 0.48
12 0.54
13 0.61
14 0.67
15 0.71
16 0.7
17 0.75
18 0.71
19 0.68
20 0.63
21 0.56
22 0.51
23 0.44
24 0.4
25 0.32
26 0.31
27 0.29
28 0.25
29 0.27
30 0.24
31 0.23
32 0.26
33 0.3
34 0.35
35 0.43
36 0.51
37 0.51
38 0.56
39 0.63
40 0.57
41 0.59
42 0.58
43 0.55
44 0.47
45 0.44
46 0.39
47 0.37
48 0.36
49 0.32
50 0.31
51 0.28
52 0.27
53 0.29
54 0.27
55 0.23
56 0.22
57 0.22
58 0.18
59 0.15
60 0.17
61 0.12
62 0.16
63 0.15
64 0.14
65 0.13
66 0.12
67 0.11
68 0.09
69 0.08
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.08
77 0.12
78 0.15
79 0.18
80 0.25
81 0.36
82 0.47
83 0.56
84 0.63
85 0.69
86 0.77
87 0.85
88 0.85
89 0.84
90 0.81
91 0.77
92 0.73
93 0.68
94 0.57
95 0.47
96 0.4
97 0.32
98 0.26
99 0.21
100 0.16
101 0.12
102 0.11
103 0.12
104 0.16
105 0.13
106 0.13
107 0.12
108 0.13
109 0.12
110 0.12
111 0.12
112 0.07
113 0.1
114 0.11
115 0.14
116 0.15
117 0.18
118 0.18
119 0.18
120 0.19
121 0.23
122 0.21
123 0.18
124 0.17
125 0.17
126 0.16
127 0.17
128 0.16
129 0.09
130 0.09
131 0.08
132 0.08
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.05
148 0.04
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.07
160 0.07
161 0.12
162 0.12
163 0.13
164 0.14
165 0.17
166 0.17
167 0.18
168 0.19
169 0.15
170 0.19
171 0.19
172 0.18
173 0.16
174 0.16
175 0.16
176 0.15
177 0.16
178 0.15
179 0.17
180 0.22
181 0.24
182 0.25
183 0.24
184 0.24
185 0.22
186 0.23
187 0.23
188 0.18
189 0.15
190 0.13
191 0.17
192 0.18
193 0.2
194 0.18
195 0.17
196 0.19
197 0.23
198 0.24
199 0.21
200 0.21
201 0.21
202 0.22
203 0.2
204 0.21
205 0.19
206 0.2
207 0.22
208 0.22
209 0.21
210 0.23
211 0.23
212 0.23
213 0.3
214 0.35
215 0.34
216 0.33
217 0.33
218 0.3
219 0.32
220 0.29
221 0.22
222 0.16
223 0.14
224 0.13
225 0.12
226 0.11
227 0.08
228 0.08
229 0.06
230 0.06
231 0.06
232 0.07
233 0.08
234 0.08
235 0.09
236 0.15
237 0.23
238 0.27
239 0.27
240 0.26
241 0.27
242 0.27
243 0.27
244 0.21
245 0.18
246 0.14
247 0.15
248 0.15
249 0.14
250 0.14
251 0.13
252 0.14
253 0.11
254 0.14
255 0.13
256 0.13
257 0.13
258 0.13
259 0.15
260 0.16
261 0.14
262 0.11
263 0.1
264 0.1
265 0.09
266 0.09
267 0.07