Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RDS9

Protein Details
Accession F4RDS9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
182-202SSPQKKSSTKGTKASKHTNKGHydrophilic
214-233NQGTEPKSKHKAKAVGKKRKBasic
NLS Segment(s)
PositionSequence
184-233PQKKSSTKGTKASKHTNKGQGEEKLPLGGGNQGTEPKSKHKAKAVGKKRK
Subcellular Location(s) nucl 15.5, cyto_nucl 13.333, mito_nucl 10.832, cyto 7
Family & Domain DBs
KEGG mlr:MELLADRAFT_95931  -  
Amino Acid Sequences MQPGTSWLVYSHKPTKEEQKIIDQGVATITQKNPDALGDNPFVSPEDLDGVDKQTFEDSRPVTNVTARLVHSGAMAGNLIRSKEIDNRAKQAFTPIAVKKELQEPVSEPKEDVPNSLSIKNRTDESHKATLVVELSDGSTPPEPILLVTQSPCAPPPNLSGHLRLRIKHPAPQSSPIKSPSSSPQKKSSTKGTKASKHTNKGQGEEKLPLGGGNQGTEPKSKHKAKAVGKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.57
4 0.61
5 0.58
6 0.59
7 0.6
8 0.59
9 0.56
10 0.45
11 0.36
12 0.3
13 0.28
14 0.19
15 0.18
16 0.17
17 0.18
18 0.19
19 0.19
20 0.18
21 0.17
22 0.19
23 0.17
24 0.21
25 0.2
26 0.19
27 0.19
28 0.19
29 0.18
30 0.16
31 0.14
32 0.1
33 0.1
34 0.1
35 0.11
36 0.11
37 0.14
38 0.14
39 0.14
40 0.13
41 0.14
42 0.14
43 0.15
44 0.2
45 0.19
46 0.2
47 0.22
48 0.23
49 0.21
50 0.23
51 0.23
52 0.19
53 0.21
54 0.19
55 0.2
56 0.18
57 0.17
58 0.14
59 0.13
60 0.11
61 0.08
62 0.08
63 0.05
64 0.06
65 0.07
66 0.07
67 0.07
68 0.07
69 0.09
70 0.15
71 0.24
72 0.3
73 0.32
74 0.37
75 0.38
76 0.38
77 0.36
78 0.35
79 0.28
80 0.21
81 0.25
82 0.22
83 0.23
84 0.24
85 0.24
86 0.2
87 0.25
88 0.26
89 0.2
90 0.19
91 0.18
92 0.24
93 0.27
94 0.25
95 0.2
96 0.19
97 0.24
98 0.23
99 0.21
100 0.16
101 0.17
102 0.19
103 0.22
104 0.22
105 0.2
106 0.22
107 0.22
108 0.22
109 0.2
110 0.23
111 0.25
112 0.29
113 0.31
114 0.29
115 0.28
116 0.27
117 0.26
118 0.22
119 0.17
120 0.11
121 0.06
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.08
136 0.1
137 0.1
138 0.11
139 0.12
140 0.12
141 0.12
142 0.13
143 0.16
144 0.2
145 0.24
146 0.26
147 0.3
148 0.32
149 0.4
150 0.41
151 0.38
152 0.37
153 0.43
154 0.43
155 0.43
156 0.45
157 0.45
158 0.47
159 0.55
160 0.56
161 0.51
162 0.53
163 0.51
164 0.48
165 0.4
166 0.39
167 0.4
168 0.45
169 0.49
170 0.49
171 0.54
172 0.6
173 0.65
174 0.67
175 0.69
176 0.68
177 0.67
178 0.72
179 0.72
180 0.72
181 0.75
182 0.82
183 0.8
184 0.78
185 0.79
186 0.79
187 0.74
188 0.7
189 0.69
190 0.65
191 0.58
192 0.54
193 0.46
194 0.37
195 0.33
196 0.28
197 0.21
198 0.19
199 0.16
200 0.14
201 0.15
202 0.17
203 0.19
204 0.23
205 0.25
206 0.28
207 0.38
208 0.44
209 0.49
210 0.55
211 0.63
212 0.69
213 0.78