Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NCQ7

Protein Details
Accession M2NCQ7    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
264-291KDLTVKVESKKQRNKNTKQTRIVKKTIPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0006334  P:nucleosome assembly  
KEGG bcom:BAUCODRAFT_147155  -  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MASSYSTNSMAMQTPQNTPAQNAPISSRAQAPQVPSINEEDLDRAAAASIFAQNPKLVSMMQNKLQGLVGRSSGYVESLPAPVRKRVAGLKGVQKEHSKLEAQFQEEVLQLEKRFFAKFTPLYEKRAKIVNGEVEPSQEEIEAGEADEEDDDEEATAAKAEADKDEAAANAKGIPEFWLSAMKNSSLAETITDRDEEALKHLVDIRMEYLDRPGFRLIFEFAQNEFFSNKTLSKTYYYQEENGYGGDFIYDHAEGEKIDWKSGKDLTVKVESKKQRNKNTKQTRIVKKTIPTPSFFDFFNPAQPPKDEDEDIDEEIEAKLELDYQLGEDIKEKLIPRAIDWFTGEALQFEQGLDDFDEDEFEDEDDDDEDEDRDEDDEDDEDDEEDGSKPKQEAAECKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.34
4 0.32
5 0.32
6 0.34
7 0.34
8 0.32
9 0.3
10 0.3
11 0.3
12 0.32
13 0.31
14 0.3
15 0.27
16 0.29
17 0.31
18 0.31
19 0.35
20 0.38
21 0.37
22 0.34
23 0.37
24 0.34
25 0.32
26 0.29
27 0.22
28 0.18
29 0.17
30 0.15
31 0.11
32 0.09
33 0.09
34 0.08
35 0.08
36 0.1
37 0.11
38 0.13
39 0.14
40 0.14
41 0.14
42 0.15
43 0.15
44 0.12
45 0.17
46 0.24
47 0.28
48 0.33
49 0.37
50 0.37
51 0.37
52 0.38
53 0.34
54 0.29
55 0.25
56 0.22
57 0.17
58 0.18
59 0.18
60 0.16
61 0.15
62 0.12
63 0.11
64 0.11
65 0.12
66 0.15
67 0.18
68 0.21
69 0.23
70 0.26
71 0.25
72 0.27
73 0.31
74 0.34
75 0.36
76 0.39
77 0.45
78 0.5
79 0.52
80 0.53
81 0.51
82 0.48
83 0.45
84 0.43
85 0.37
86 0.31
87 0.37
88 0.36
89 0.35
90 0.34
91 0.31
92 0.28
93 0.26
94 0.25
95 0.18
96 0.17
97 0.14
98 0.14
99 0.16
100 0.15
101 0.15
102 0.15
103 0.15
104 0.2
105 0.22
106 0.27
107 0.36
108 0.37
109 0.43
110 0.49
111 0.49
112 0.43
113 0.46
114 0.41
115 0.34
116 0.36
117 0.36
118 0.3
119 0.31
120 0.29
121 0.23
122 0.23
123 0.21
124 0.17
125 0.1
126 0.09
127 0.07
128 0.07
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.03
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.06
149 0.08
150 0.08
151 0.08
152 0.08
153 0.09
154 0.1
155 0.09
156 0.09
157 0.08
158 0.08
159 0.08
160 0.07
161 0.09
162 0.08
163 0.08
164 0.08
165 0.12
166 0.12
167 0.14
168 0.15
169 0.14
170 0.14
171 0.14
172 0.14
173 0.09
174 0.09
175 0.08
176 0.08
177 0.09
178 0.09
179 0.09
180 0.08
181 0.08
182 0.09
183 0.08
184 0.1
185 0.11
186 0.1
187 0.1
188 0.13
189 0.13
190 0.12
191 0.12
192 0.11
193 0.09
194 0.1
195 0.09
196 0.1
197 0.12
198 0.12
199 0.13
200 0.13
201 0.12
202 0.12
203 0.14
204 0.12
205 0.12
206 0.13
207 0.12
208 0.12
209 0.14
210 0.14
211 0.14
212 0.12
213 0.11
214 0.11
215 0.12
216 0.13
217 0.12
218 0.13
219 0.14
220 0.18
221 0.2
222 0.2
223 0.25
224 0.25
225 0.25
226 0.26
227 0.25
228 0.21
229 0.19
230 0.18
231 0.12
232 0.09
233 0.07
234 0.06
235 0.05
236 0.06
237 0.06
238 0.06
239 0.06
240 0.07
241 0.06
242 0.08
243 0.14
244 0.12
245 0.14
246 0.15
247 0.16
248 0.19
249 0.21
250 0.24
251 0.21
252 0.23
253 0.25
254 0.33
255 0.35
256 0.34
257 0.42
258 0.45
259 0.52
260 0.6
261 0.65
262 0.67
263 0.75
264 0.82
265 0.85
266 0.88
267 0.88
268 0.89
269 0.9
270 0.9
271 0.87
272 0.84
273 0.78
274 0.72
275 0.7
276 0.7
277 0.62
278 0.55
279 0.51
280 0.48
281 0.44
282 0.39
283 0.33
284 0.28
285 0.26
286 0.29
287 0.29
288 0.27
289 0.28
290 0.29
291 0.31
292 0.3
293 0.34
294 0.27
295 0.24
296 0.29
297 0.29
298 0.29
299 0.25
300 0.21
301 0.17
302 0.16
303 0.15
304 0.09
305 0.06
306 0.05
307 0.06
308 0.06
309 0.06
310 0.06
311 0.06
312 0.09
313 0.09
314 0.1
315 0.1
316 0.12
317 0.12
318 0.16
319 0.16
320 0.18
321 0.22
322 0.23
323 0.22
324 0.29
325 0.3
326 0.28
327 0.29
328 0.27
329 0.23
330 0.24
331 0.22
332 0.14
333 0.14
334 0.12
335 0.11
336 0.09
337 0.09
338 0.08
339 0.09
340 0.09
341 0.09
342 0.09
343 0.09
344 0.1
345 0.09
346 0.11
347 0.09
348 0.09
349 0.09
350 0.08
351 0.09
352 0.09
353 0.09
354 0.09
355 0.09
356 0.09
357 0.09
358 0.09
359 0.09
360 0.09
361 0.1
362 0.1
363 0.1
364 0.11
365 0.11
366 0.11
367 0.11
368 0.11
369 0.1
370 0.1
371 0.1
372 0.1
373 0.12
374 0.12
375 0.15
376 0.15
377 0.19
378 0.23
379 0.28
380 0.36