Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4S5B4

Protein Details
Accession F4S5B4    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
157-202APDPERWLPRKKRSDYCPPQRQHTKEVSVPKTRKPKEKSGNTQGSMHydrophilic
NLS Segment(s)
PositionSequence
142-169PSTPKMKKPLDPSRPAPDPERWLPRKKR
189-192RKPK
214-225DKGTKGKRRVKR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013699  Signal_recog_part_SRP72_RNA-bd  
IPR026270  SRP72  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG mlr:MELLADRAFT_93804  -  
Pfam View protein in Pfam  
PF08492  SRP72  
Amino Acid Sequences MRLVQCYCLYKTSDITGAWNLLSNIDEELDPSGKRIKTLLEAQILSRLERYEEAKDHYEDLLVDSDPTHPEYQDLTVNLANVRRRLQFETIAAPSLLTSIDLDRLESTPVTSSFFQSHPDFQPTKPIKATGVAIPNQPAKPPSTPKMKKPLDPSRPAPDPERWLPRKKRSDYCPPQRQHTKEVSVPKTRKPKEKSGNTQGSMNEPERNSSVKLDKGTKGKRRVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.26
4 0.24
5 0.22
6 0.21
7 0.18
8 0.15
9 0.15
10 0.12
11 0.11
12 0.1
13 0.1
14 0.08
15 0.11
16 0.12
17 0.12
18 0.13
19 0.19
20 0.19
21 0.19
22 0.2
23 0.2
24 0.23
25 0.3
26 0.34
27 0.33
28 0.33
29 0.33
30 0.38
31 0.36
32 0.31
33 0.26
34 0.2
35 0.16
36 0.18
37 0.21
38 0.2
39 0.22
40 0.26
41 0.28
42 0.29
43 0.29
44 0.27
45 0.24
46 0.19
47 0.18
48 0.15
49 0.11
50 0.1
51 0.09
52 0.1
53 0.11
54 0.13
55 0.12
56 0.1
57 0.11
58 0.12
59 0.13
60 0.15
61 0.14
62 0.14
63 0.14
64 0.15
65 0.15
66 0.17
67 0.18
68 0.17
69 0.2
70 0.2
71 0.22
72 0.25
73 0.27
74 0.26
75 0.25
76 0.28
77 0.25
78 0.24
79 0.2
80 0.17
81 0.14
82 0.11
83 0.1
84 0.05
85 0.05
86 0.04
87 0.07
88 0.07
89 0.07
90 0.08
91 0.08
92 0.09
93 0.08
94 0.08
95 0.07
96 0.08
97 0.1
98 0.1
99 0.11
100 0.12
101 0.12
102 0.16
103 0.16
104 0.19
105 0.18
106 0.23
107 0.23
108 0.21
109 0.31
110 0.3
111 0.32
112 0.3
113 0.29
114 0.24
115 0.24
116 0.26
117 0.19
118 0.21
119 0.2
120 0.2
121 0.21
122 0.24
123 0.23
124 0.22
125 0.19
126 0.17
127 0.21
128 0.26
129 0.29
130 0.36
131 0.4
132 0.46
133 0.56
134 0.57
135 0.58
136 0.63
137 0.68
138 0.66
139 0.69
140 0.68
141 0.64
142 0.65
143 0.62
144 0.56
145 0.5
146 0.47
147 0.47
148 0.52
149 0.5
150 0.56
151 0.63
152 0.69
153 0.74
154 0.76
155 0.78
156 0.75
157 0.81
158 0.82
159 0.83
160 0.83
161 0.77
162 0.79
163 0.8
164 0.77
165 0.73
166 0.7
167 0.65
168 0.61
169 0.67
170 0.64
171 0.64
172 0.63
173 0.65
174 0.68
175 0.69
176 0.73
177 0.7
178 0.74
179 0.74
180 0.81
181 0.83
182 0.83
183 0.86
184 0.78
185 0.75
186 0.65
187 0.6
188 0.55
189 0.47
190 0.42
191 0.32
192 0.34
193 0.32
194 0.34
195 0.3
196 0.31
197 0.34
198 0.33
199 0.39
200 0.41
201 0.45
202 0.53
203 0.61
204 0.65
205 0.7