Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NNM0

Protein Details
Accession M2NNM0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-105IPRVNLKSRNGSRRRHKQTNKLPLGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 7.5, cyto 3
Family & Domain DBs
KEGG bcom:BAUCODRAFT_118822  -  
Amino Acid Sequences MCCSSSRSRGGGGLRGSRRGDEEGAGAHLKPTSSVNACGLMGRFQGFPMCPRSADSFLTMPLTSRGLTLKFGAYSEASVIPRVNLKSRNGSRRRHKQTNKLPLGVTHGFTLTSTTLTSTVKAHNSSNSAAYHPEQYILQFWSADGHADVPIERPCRACSQAAIVRDDIDHVALFPLRPWGLYANLGVHGMQEEVLRGVYAPPGASRIRWHAGQARDKDWHGRSKKLQQTAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.47
4 0.43
5 0.43
6 0.4
7 0.36
8 0.28
9 0.25
10 0.2
11 0.22
12 0.22
13 0.18
14 0.15
15 0.15
16 0.13
17 0.13
18 0.14
19 0.16
20 0.17
21 0.2
22 0.2
23 0.21
24 0.21
25 0.22
26 0.21
27 0.17
28 0.16
29 0.15
30 0.13
31 0.12
32 0.15
33 0.14
34 0.16
35 0.2
36 0.2
37 0.19
38 0.22
39 0.27
40 0.27
41 0.28
42 0.28
43 0.23
44 0.22
45 0.24
46 0.21
47 0.17
48 0.15
49 0.15
50 0.12
51 0.12
52 0.13
53 0.11
54 0.13
55 0.13
56 0.13
57 0.12
58 0.12
59 0.13
60 0.11
61 0.1
62 0.11
63 0.12
64 0.11
65 0.12
66 0.12
67 0.11
68 0.14
69 0.15
70 0.18
71 0.2
72 0.22
73 0.31
74 0.38
75 0.48
76 0.52
77 0.6
78 0.66
79 0.73
80 0.8
81 0.81
82 0.82
83 0.82
84 0.85
85 0.87
86 0.82
87 0.73
88 0.64
89 0.54
90 0.53
91 0.43
92 0.33
93 0.23
94 0.17
95 0.15
96 0.14
97 0.15
98 0.08
99 0.07
100 0.06
101 0.06
102 0.07
103 0.07
104 0.08
105 0.08
106 0.1
107 0.12
108 0.14
109 0.14
110 0.15
111 0.17
112 0.17
113 0.19
114 0.17
115 0.16
116 0.16
117 0.16
118 0.16
119 0.14
120 0.14
121 0.11
122 0.11
123 0.12
124 0.11
125 0.11
126 0.08
127 0.08
128 0.09
129 0.09
130 0.09
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.08
137 0.12
138 0.14
139 0.14
140 0.15
141 0.17
142 0.21
143 0.24
144 0.22
145 0.19
146 0.25
147 0.29
148 0.3
149 0.3
150 0.26
151 0.24
152 0.23
153 0.23
154 0.15
155 0.12
156 0.09
157 0.07
158 0.08
159 0.08
160 0.08
161 0.07
162 0.11
163 0.1
164 0.1
165 0.11
166 0.12
167 0.14
168 0.15
169 0.16
170 0.14
171 0.14
172 0.15
173 0.13
174 0.12
175 0.1
176 0.09
177 0.08
178 0.07
179 0.07
180 0.07
181 0.07
182 0.07
183 0.06
184 0.07
185 0.08
186 0.08
187 0.08
188 0.08
189 0.12
190 0.13
191 0.14
192 0.18
193 0.23
194 0.27
195 0.28
196 0.32
197 0.36
198 0.44
199 0.51
200 0.52
201 0.51
202 0.52
203 0.53
204 0.57
205 0.55
206 0.57
207 0.53
208 0.57
209 0.6
210 0.66
211 0.72