Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MHT6

Protein Details
Accession M2MHT6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MSEAVRRRKTQHNKKKKGWKGRVVSCRTRLHydrophilic
NLS Segment(s)
PositionSequence
6-22RRRKTQHNKKKKGWKGR
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_33530  -  
Amino Acid Sequences MSEAVRRRKTQHNKKKKGWKGRVVSCRTRLCIRQSVQIELCSLTQSPSAHLTIEMKAAGRGTAACRLLFAPTRHAIPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.94
3 0.93
4 0.93
5 0.92
6 0.9
7 0.88
8 0.88
9 0.88
10 0.84
11 0.82
12 0.79
13 0.73
14 0.67
15 0.61
16 0.56
17 0.51
18 0.52
19 0.46
20 0.45
21 0.42
22 0.43
23 0.39
24 0.36
25 0.31
26 0.23
27 0.22
28 0.14
29 0.13
30 0.09
31 0.1
32 0.09
33 0.1
34 0.12
35 0.12
36 0.12
37 0.12
38 0.13
39 0.12
40 0.13
41 0.12
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.09
48 0.1
49 0.16
50 0.17
51 0.16
52 0.17
53 0.18
54 0.21
55 0.27
56 0.26
57 0.26
58 0.28