Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N3I9

Protein Details
Accession M2N3I9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
119-142LRSDAKKGRGAKERKRRLGNDAFLBasic
NLS Segment(s)
PositionSequence
123-135AKKGRGAKERKRR
Subcellular Location(s) extr 12, plas 6, mito 3, golg 3, pero 1, E.R. 1, vacu 1
Family & Domain DBs
KEGG bcom:BAUCODRAFT_429053  -  
Amino Acid Sequences MQHSLRSRDPHRVQAAITSVTMVLPVLLLLPQQSDQRHLQQFLQAVYTWAREYGADMRNLFIEFIVWIRQGSRIRFPGDLQEQSRKEKLPTWAEEDEGGLLRIHQEVCIAVSDAANGDLRSDAKKGRGAKERKRRLGNDAFLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.37
4 0.32
5 0.23
6 0.18
7 0.16
8 0.16
9 0.1
10 0.06
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.06
18 0.07
19 0.11
20 0.12
21 0.16
22 0.2
23 0.28
24 0.31
25 0.32
26 0.31
27 0.31
28 0.33
29 0.29
30 0.27
31 0.19
32 0.17
33 0.16
34 0.16
35 0.12
36 0.1
37 0.1
38 0.08
39 0.1
40 0.15
41 0.17
42 0.18
43 0.18
44 0.18
45 0.19
46 0.19
47 0.17
48 0.1
49 0.07
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.11
57 0.14
58 0.16
59 0.2
60 0.21
61 0.23
62 0.24
63 0.24
64 0.26
65 0.27
66 0.3
67 0.28
68 0.33
69 0.33
70 0.36
71 0.38
72 0.33
73 0.3
74 0.31
75 0.35
76 0.34
77 0.35
78 0.38
79 0.36
80 0.35
81 0.34
82 0.3
83 0.23
84 0.17
85 0.15
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.07
92 0.07
93 0.06
94 0.07
95 0.08
96 0.09
97 0.08
98 0.08
99 0.08
100 0.08
101 0.09
102 0.09
103 0.08
104 0.07
105 0.08
106 0.1
107 0.12
108 0.14
109 0.15
110 0.18
111 0.25
112 0.3
113 0.38
114 0.47
115 0.55
116 0.63
117 0.72
118 0.79
119 0.83
120 0.87
121 0.82
122 0.82
123 0.82