Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2N3I9

Protein Details
Accession M2N3I9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
119-142LRSDAKKGRGAKERKRRLGNDAFLBasic
NLS Segment(s)
PositionSequence
123-135AKKGRGAKERKRR
Subcellular Location(s) extr 12, plas 6, mito 3, golg 3, pero 1, E.R. 1, vacu 1
Family & Domain DBs
KEGG bcom:BAUCODRAFT_429053  -  
Amino Acid Sequences MQHSLRSRDPHRVQAAITSVTMVLPVLLLLPQQSDQRHLQQFLQAVYTWAREYGADMRNLFIEFIVWIRQGSRIRFPGDLQEQSRKEKLPTWAEEDEGGLLRIHQEVCIAVSDAANGDLRSDAKKGRGAKERKRRLGNDAFLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.37
4 0.32
5 0.23
6 0.18
7 0.16
8 0.16
9 0.1
10 0.06
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.06
18 0.07
19 0.11
20 0.12
21 0.16
22 0.2
23 0.28
24 0.31
25 0.32
26 0.31
27 0.31
28 0.33
29 0.29
30 0.27
31 0.19
32 0.17
33 0.16
34 0.16
35 0.12
36 0.1
37 0.1
38 0.08
39 0.1
40 0.15
41 0.17
42 0.18
43 0.18
44 0.18
45 0.19
46 0.19
47 0.17
48 0.1
49 0.07
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.11
57 0.14
58 0.16
59 0.2
60 0.21
61 0.23
62 0.24
63 0.24
64 0.26
65 0.27
66 0.3
67 0.28
68 0.33
69 0.33
70 0.36
71 0.38
72 0.33
73 0.3
74 0.31
75 0.35
76 0.34
77 0.35
78 0.38
79 0.36
80 0.35
81 0.34
82 0.3
83 0.23
84 0.17
85 0.15
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.07
92 0.07
93 0.06
94 0.07
95 0.08
96 0.09
97 0.08
98 0.08
99 0.08
100 0.08
101 0.09
102 0.09
103 0.08
104 0.07
105 0.08
106 0.1
107 0.12
108 0.14
109 0.15
110 0.18
111 0.25
112 0.3
113 0.38
114 0.47
115 0.55
116 0.63
117 0.72
118 0.79
119 0.83
120 0.87
121 0.82
122 0.82
123 0.82