Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2M9G8

Protein Details
Accession M2M9G8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-33SDWLHRRRSGGRRKTRKWILYRBasic
NLS Segment(s)
PositionSequence
17-28RRRSGGRRKTRK
Subcellular Location(s) mito 25
Family & Domain DBs
KEGG bcom:BAUCODRAFT_37958  -  
Amino Acid Sequences MLRSAAALCCASDWLHRRRSGGRRKTRKWILYRLDIDACHCLEVHDEGTVYTQPRAVQQLTISVRNMVLLKVAGGPTEDHGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.37
4 0.4
5 0.47
6 0.57
7 0.61
8 0.65
9 0.7
10 0.73
11 0.77
12 0.84
13 0.85
14 0.83
15 0.8
16 0.79
17 0.74
18 0.72
19 0.68
20 0.61
21 0.53
22 0.44
23 0.39
24 0.31
25 0.25
26 0.16
27 0.14
28 0.1
29 0.09
30 0.1
31 0.09
32 0.07
33 0.07
34 0.06
35 0.08
36 0.09
37 0.09
38 0.08
39 0.09
40 0.1
41 0.12
42 0.15
43 0.14
44 0.14
45 0.14
46 0.22
47 0.24
48 0.26
49 0.25
50 0.22
51 0.22
52 0.22
53 0.22
54 0.14
55 0.12
56 0.1
57 0.1
58 0.12
59 0.12
60 0.1
61 0.11
62 0.12