Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MXQ1

Protein Details
Accession M2MXQ1    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
190-211KVSEKEVKGKAKKAKKVKCVVMHydrophilic
NLS Segment(s)
PositionSequence
193-206EKEVKGKAKKAKKV
Subcellular Location(s) cyto 21.5, cyto_nucl 13, nucl 3.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_470891  -  
Amino Acid Sequences MAATDPEPNSLDTLMAEPSSPSTLPQNYSLHLITDDGLPKYDAIIPPQPFATSSSGRSFVLTLSHCAPGNINKRNKVLSGKTIEIITEAITLIPTTSYRQLVLHCLQRVDKRFEIKVQPGCGQKLGGGFAVCTGGEDREAEITVQDEEGWRAARALMWEKPEAKVRFVFALIPDAYRETKVEEKEARVEKVSEKEVKGKAKKAKKVKCVVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.11
6 0.13
7 0.12
8 0.12
9 0.17
10 0.2
11 0.23
12 0.28
13 0.28
14 0.27
15 0.31
16 0.3
17 0.25
18 0.22
19 0.2
20 0.15
21 0.17
22 0.19
23 0.15
24 0.16
25 0.15
26 0.14
27 0.15
28 0.18
29 0.16
30 0.17
31 0.24
32 0.25
33 0.26
34 0.26
35 0.25
36 0.22
37 0.24
38 0.24
39 0.19
40 0.21
41 0.23
42 0.24
43 0.24
44 0.24
45 0.21
46 0.16
47 0.19
48 0.16
49 0.16
50 0.16
51 0.18
52 0.18
53 0.17
54 0.18
55 0.22
56 0.3
57 0.35
58 0.38
59 0.41
60 0.43
61 0.45
62 0.46
63 0.45
64 0.39
65 0.38
66 0.37
67 0.34
68 0.33
69 0.31
70 0.28
71 0.22
72 0.19
73 0.12
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.06
83 0.08
84 0.08
85 0.09
86 0.1
87 0.11
88 0.15
89 0.18
90 0.21
91 0.2
92 0.2
93 0.22
94 0.26
95 0.3
96 0.31
97 0.3
98 0.29
99 0.29
100 0.33
101 0.35
102 0.37
103 0.37
104 0.34
105 0.36
106 0.35
107 0.34
108 0.31
109 0.26
110 0.21
111 0.18
112 0.16
113 0.12
114 0.09
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.06
121 0.05
122 0.06
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.07
130 0.07
131 0.07
132 0.06
133 0.06
134 0.06
135 0.08
136 0.09
137 0.08
138 0.08
139 0.08
140 0.09
141 0.12
142 0.16
143 0.18
144 0.2
145 0.23
146 0.24
147 0.27
148 0.35
149 0.33
150 0.32
151 0.3
152 0.29
153 0.28
154 0.27
155 0.26
156 0.18
157 0.22
158 0.19
159 0.18
160 0.17
161 0.18
162 0.19
163 0.18
164 0.18
165 0.17
166 0.22
167 0.24
168 0.31
169 0.32
170 0.34
171 0.42
172 0.47
173 0.45
174 0.41
175 0.41
176 0.39
177 0.41
178 0.44
179 0.42
180 0.4
181 0.45
182 0.49
183 0.57
184 0.6
185 0.62
186 0.65
187 0.69
188 0.76
189 0.79
190 0.82
191 0.82