Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4R400

Protein Details
Accession F4R400    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-108DLNVTKKRKTVPKPKGTKDKGVPBasic
NLS Segment(s)
PositionSequence
91-103KKRKTVPKPKGTK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG mlr:MELLADRAFT_86958  -  
Amino Acid Sequences MTYTMPTSTGPSTSKSLAPPSSTPVRQLRNRSPQQPSPGFVLTGSDSRRRITREGSNPASHPTTPVSTSKDSAKRGREEANNDEPDLNVTKKRKTVPKPKGTKDKGVPTVVNVDQDSSGDENEAVETRPGHRGDVKELMRYYGAPKHYKDEVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.32
4 0.31
5 0.34
6 0.32
7 0.34
8 0.4
9 0.38
10 0.41
11 0.43
12 0.48
13 0.51
14 0.59
15 0.63
16 0.65
17 0.72
18 0.73
19 0.74
20 0.72
21 0.74
22 0.69
23 0.61
24 0.55
25 0.48
26 0.41
27 0.32
28 0.28
29 0.2
30 0.21
31 0.21
32 0.21
33 0.21
34 0.23
35 0.26
36 0.28
37 0.28
38 0.3
39 0.37
40 0.4
41 0.47
42 0.5
43 0.49
44 0.47
45 0.47
46 0.44
47 0.34
48 0.27
49 0.21
50 0.18
51 0.18
52 0.19
53 0.2
54 0.19
55 0.21
56 0.26
57 0.29
58 0.32
59 0.36
60 0.39
61 0.37
62 0.38
63 0.43
64 0.4
65 0.4
66 0.42
67 0.44
68 0.4
69 0.38
70 0.35
71 0.29
72 0.26
73 0.24
74 0.18
75 0.16
76 0.17
77 0.2
78 0.24
79 0.3
80 0.38
81 0.45
82 0.55
83 0.61
84 0.69
85 0.76
86 0.8
87 0.85
88 0.81
89 0.8
90 0.76
91 0.75
92 0.7
93 0.65
94 0.56
95 0.47
96 0.48
97 0.4
98 0.35
99 0.26
100 0.21
101 0.17
102 0.17
103 0.17
104 0.12
105 0.11
106 0.09
107 0.09
108 0.08
109 0.09
110 0.09
111 0.08
112 0.09
113 0.1
114 0.11
115 0.18
116 0.18
117 0.2
118 0.24
119 0.26
120 0.3
121 0.39
122 0.39
123 0.4
124 0.39
125 0.39
126 0.35
127 0.34
128 0.32
129 0.29
130 0.34
131 0.33
132 0.35
133 0.39
134 0.43