Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2NHK0

Protein Details
Accession M2NHK0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
204-246RKAFELSKKRREWHNKYGAAKRTYDEKREARRREKEMRYNAGABasic
NLS Segment(s)
PositionSequence
210-238SKKRREWHNKYGAAKRTYDEKREARRREK
Subcellular Location(s) cyto 10, nucl 9, pero 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR018856  Stn1_N  
KEGG bcom:BAUCODRAFT_66325  -  
Pfam View protein in Pfam  
PF10451  Stn1  
CDD cd03524  RPA2_OBF_family  
Amino Acid Sequences MSDEVATCTSYPKRYFNASQTWDHWNPLTATDIHALRTESGFEGQKIYFFGYHPIRYTRVVGILVDIELRGRYTILTIDDSSGACIDVKIEARRVTRGDNAECPSNTTVDNVDIHVIIGSGPTIHLHRKPLEIGSVLKVKGTISAFRGVRQIELKRLFTVDDTNAEARAWAETAKWKRDVLAEDWILTRQQQHEIDERCRQEERKAFELSKKRREWHNKYGAAKRTYDEKREARRREKEMRYNAGALKGSHLIPAPWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.52
4 0.57
5 0.55
6 0.57
7 0.55
8 0.59
9 0.53
10 0.5
11 0.43
12 0.36
13 0.32
14 0.28
15 0.28
16 0.19
17 0.2
18 0.22
19 0.22
20 0.2
21 0.21
22 0.2
23 0.18
24 0.18
25 0.17
26 0.14
27 0.17
28 0.18
29 0.16
30 0.19
31 0.17
32 0.18
33 0.17
34 0.18
35 0.15
36 0.14
37 0.2
38 0.23
39 0.25
40 0.27
41 0.29
42 0.3
43 0.31
44 0.33
45 0.27
46 0.24
47 0.23
48 0.2
49 0.18
50 0.16
51 0.14
52 0.11
53 0.09
54 0.07
55 0.06
56 0.07
57 0.06
58 0.05
59 0.05
60 0.06
61 0.08
62 0.09
63 0.11
64 0.11
65 0.12
66 0.13
67 0.13
68 0.13
69 0.11
70 0.1
71 0.07
72 0.06
73 0.06
74 0.07
75 0.1
76 0.11
77 0.14
78 0.18
79 0.19
80 0.22
81 0.23
82 0.24
83 0.26
84 0.3
85 0.29
86 0.31
87 0.31
88 0.33
89 0.31
90 0.31
91 0.27
92 0.23
93 0.2
94 0.16
95 0.14
96 0.12
97 0.12
98 0.09
99 0.09
100 0.08
101 0.08
102 0.07
103 0.06
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.04
110 0.05
111 0.07
112 0.09
113 0.13
114 0.14
115 0.15
116 0.16
117 0.16
118 0.17
119 0.16
120 0.15
121 0.15
122 0.17
123 0.15
124 0.14
125 0.14
126 0.12
127 0.14
128 0.14
129 0.13
130 0.12
131 0.18
132 0.19
133 0.19
134 0.22
135 0.19
136 0.2
137 0.23
138 0.23
139 0.25
140 0.28
141 0.29
142 0.26
143 0.27
144 0.25
145 0.21
146 0.22
147 0.15
148 0.14
149 0.15
150 0.15
151 0.15
152 0.14
153 0.13
154 0.1
155 0.1
156 0.08
157 0.06
158 0.06
159 0.14
160 0.2
161 0.24
162 0.26
163 0.26
164 0.27
165 0.3
166 0.33
167 0.28
168 0.3
169 0.27
170 0.26
171 0.26
172 0.26
173 0.22
174 0.19
175 0.19
176 0.13
177 0.19
178 0.2
179 0.22
180 0.3
181 0.35
182 0.4
183 0.44
184 0.45
185 0.42
186 0.44
187 0.42
188 0.43
189 0.45
190 0.46
191 0.44
192 0.47
193 0.47
194 0.51
195 0.6
196 0.61
197 0.64
198 0.64
199 0.64
200 0.7
201 0.78
202 0.79
203 0.79
204 0.8
205 0.78
206 0.79
207 0.82
208 0.81
209 0.73
210 0.66
211 0.57
212 0.56
213 0.55
214 0.53
215 0.53
216 0.54
217 0.61
218 0.7
219 0.78
220 0.78
221 0.81
222 0.84
223 0.85
224 0.86
225 0.86
226 0.85
227 0.84
228 0.78
229 0.74
230 0.68
231 0.63
232 0.56
233 0.46
234 0.4
235 0.34
236 0.29
237 0.27
238 0.25