Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MZE6

Protein Details
Accession M2MZE6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 14.5, mito_nucl 12, mito 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG bcom:BAUCODRAFT_78656  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHAVVLDKNITDKLDKDVQSYRLITVAVLVDRLKINGSVARRALADLEEKGQIRKVVAHSACNVYSESRSFKCFTLSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.93
8 0.9
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.52
15 0.43
16 0.38
17 0.31
18 0.23
19 0.22
20 0.19
21 0.19
22 0.13
23 0.12
24 0.14
25 0.2
26 0.2
27 0.22
28 0.25
29 0.27
30 0.29
31 0.29
32 0.24
33 0.19
34 0.18
35 0.15
36 0.12
37 0.1
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.07
47 0.09
48 0.11
49 0.14
50 0.14
51 0.15
52 0.15
53 0.15
54 0.15
55 0.13
56 0.14
57 0.11
58 0.12
59 0.14
60 0.15
61 0.15
62 0.17
63 0.17
64 0.15
65 0.18
66 0.19
67 0.25
68 0.26
69 0.29
70 0.29
71 0.33
72 0.33
73 0.3
74 0.28
75 0.21
76 0.22
77 0.23
78 0.26
79 0.24
80 0.27
81 0.28
82 0.28
83 0.3