Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4ECB9

Protein Details
Accession A0A0C4ECB9   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92CTECRKKRAKVGSRRRTWSSHydrophilic
NLS Segment(s)
PositionSequence
78-88KKRAKVGSRRR
125-125R
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MDAMDITDDDGGPERISVTSPSPKPSAADTSTTPSVGASHGKQPVTSPPAATASSSTQPKRKRGHGIVTPNACTECRKKRAKVGSRRRTWSSAETRHADRPPFRAALAVRRCHAVLEVQIPKGRRVRLRSPRAPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.13
5 0.15
6 0.23
7 0.25
8 0.29
9 0.3
10 0.31
11 0.31
12 0.32
13 0.34
14 0.27
15 0.28
16 0.26
17 0.31
18 0.31
19 0.3
20 0.26
21 0.19
22 0.18
23 0.16
24 0.17
25 0.13
26 0.17
27 0.21
28 0.21
29 0.21
30 0.22
31 0.27
32 0.28
33 0.27
34 0.22
35 0.19
36 0.22
37 0.22
38 0.21
39 0.16
40 0.14
41 0.19
42 0.23
43 0.23
44 0.27
45 0.33
46 0.41
47 0.44
48 0.47
49 0.52
50 0.52
51 0.58
52 0.59
53 0.61
54 0.6
55 0.57
56 0.51
57 0.43
58 0.38
59 0.3
60 0.25
61 0.24
62 0.27
63 0.33
64 0.39
65 0.41
66 0.5
67 0.6
68 0.67
69 0.72
70 0.75
71 0.76
72 0.78
73 0.81
74 0.77
75 0.7
76 0.64
77 0.61
78 0.59
79 0.56
80 0.54
81 0.52
82 0.51
83 0.54
84 0.54
85 0.51
86 0.45
87 0.42
88 0.4
89 0.37
90 0.34
91 0.32
92 0.3
93 0.35
94 0.39
95 0.39
96 0.35
97 0.37
98 0.37
99 0.33
100 0.32
101 0.25
102 0.2
103 0.25
104 0.28
105 0.29
106 0.32
107 0.33
108 0.38
109 0.41
110 0.44
111 0.43
112 0.47
113 0.55
114 0.63
115 0.72