Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E8I4

Protein Details
Accession A0A0C4E8I4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-104GHWPKGKPLHKRRNIGNDKRYQBasic
NLS Segment(s)
PositionSequence
61-96SVRKNPAKPPPRSKTPPKGNPIGHWPKGKPLHKRRN
Subcellular Location(s) extr 9, mito 6, cyto 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MHAKFLLPFLIAGALAAPPNKSNVGAKSQADLAKAHKDAYPQVSTHYLKQNNFRDKNGNPSVRKNPAKPPPRSKTPPKGNPIGHWPKGKPLHKRRNIGNDKRYQSAGEEAFLAARGEHVNKDEDGAEVKEADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.08
6 0.11
7 0.12
8 0.13
9 0.16
10 0.18
11 0.23
12 0.27
13 0.28
14 0.27
15 0.31
16 0.31
17 0.29
18 0.27
19 0.24
20 0.26
21 0.26
22 0.25
23 0.22
24 0.22
25 0.25
26 0.29
27 0.28
28 0.21
29 0.23
30 0.28
31 0.29
32 0.31
33 0.36
34 0.35
35 0.36
36 0.45
37 0.51
38 0.55
39 0.56
40 0.54
41 0.52
42 0.48
43 0.55
44 0.54
45 0.52
46 0.45
47 0.49
48 0.53
49 0.56
50 0.58
51 0.52
52 0.53
53 0.55
54 0.61
55 0.62
56 0.66
57 0.63
58 0.68
59 0.72
60 0.73
61 0.74
62 0.75
63 0.76
64 0.71
65 0.73
66 0.66
67 0.61
68 0.62
69 0.6
70 0.55
71 0.51
72 0.46
73 0.47
74 0.54
75 0.58
76 0.59
77 0.62
78 0.67
79 0.71
80 0.78
81 0.77
82 0.79
83 0.83
84 0.83
85 0.81
86 0.79
87 0.74
88 0.71
89 0.64
90 0.53
91 0.45
92 0.41
93 0.33
94 0.24
95 0.21
96 0.18
97 0.17
98 0.17
99 0.14
100 0.08
101 0.08
102 0.09
103 0.11
104 0.12
105 0.14
106 0.16
107 0.16
108 0.18
109 0.17
110 0.16
111 0.18
112 0.18
113 0.17