Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E2Q4

Protein Details
Accession A0A0C4E2Q4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-92VSYCPQCQEHKRQKGSQCPRPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MTQQSVTSSPKRTGCRLGTHVIPQPAVSAPTPLAASKKLGHASTAGDGNVGVSEHLIVASISKPCDWLPLSVSYCPQCQEHKRQKGSQCPRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.53
4 0.52
5 0.48
6 0.49
7 0.49
8 0.43
9 0.38
10 0.3
11 0.27
12 0.23
13 0.21
14 0.16
15 0.12
16 0.1
17 0.11
18 0.12
19 0.11
20 0.11
21 0.11
22 0.13
23 0.13
24 0.16
25 0.18
26 0.17
27 0.17
28 0.16
29 0.17
30 0.16
31 0.15
32 0.11
33 0.09
34 0.08
35 0.08
36 0.07
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.14
53 0.14
54 0.14
55 0.16
56 0.22
57 0.25
58 0.25
59 0.29
60 0.27
61 0.27
62 0.27
63 0.28
64 0.29
65 0.34
66 0.44
67 0.52
68 0.6
69 0.67
70 0.73
71 0.79
72 0.82