Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E165

Protein Details
Accession A0A0C4E165    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-37RCLEWGKKTKSQNGRCRCRCRCRKGKSPSAAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MAPPARCLEWGKKTKSQNGRCRCRCRCRKGKSPSAAIAAPRALLDYCLGSPGLCDLVIAMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.75
4 0.75
5 0.77
6 0.82
7 0.83
8 0.87
9 0.87
10 0.88
11 0.88
12 0.88
13 0.88
14 0.86
15 0.86
16 0.85
17 0.85
18 0.8
19 0.76
20 0.68
21 0.61
22 0.54
23 0.44
24 0.37
25 0.28
26 0.21
27 0.15
28 0.13
29 0.09
30 0.08
31 0.09
32 0.08
33 0.08
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.07
41 0.07