Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E0E5

Protein Details
Accession A0A0C4E0E5   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
315-356VERAYPRGRRDGPRLRRRRGRRLPRRRPRRPAGCHLDRQVKMBasic
NLS Segment(s)
PositionSequence
320-345PRGRRDGPRLRRRRGRRLPRRRPRRP
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025721  Exosome_cplx_N_dom  
IPR026699  Exosome_RNA_bind1/RRP40/RRP4  
IPR036612  KH_dom_type_1_sf  
IPR012340  NA-bd_OB-fold  
Gene Ontology GO:0000785  C:chromatin  
GO:0000177  C:cytoplasmic exosome (RNase complex)  
GO:0000176  C:nuclear exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0003723  F:RNA binding  
GO:0000467  P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0071028  P:nuclear mRNA surveillance  
GO:0071035  P:nuclear polyadenylation-dependent rRNA catabolic process  
GO:0071038  P:nuclear polyadenylation-dependent tRNA catabolic process  
GO:0034427  P:nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'  
GO:0071051  P:polyadenylation-dependent snoRNA 3'-end processing  
GO:0034475  P:U4 snRNA 3'-end processing  
Pfam View protein in Pfam  
PF14382  ECR1_N  
CDD cd05789  S1_Rrp4  
Amino Acid Sequences MPVTILAPRPQQQPQHDADPDAGGDIVTPGEVITSDPQWMRGHGTYTILPSPAIISSVAGTVSRTNKLLSVRPVRARYTPEVGDLVVGRIVEVQARRWRVDVGGAQLAALPLSAINLPGGVLRKRTDTDELQIRSFFAEGDLLVAEVQQLFGDGGAGLHTRSLRYGKLRNGLFASVSGVGGGGGVVRARRQVWTMDVSSTAPSSSVSTARKHHQHSSQTTTAQNPTNNRSIDVVLGVNGYVWISKHVESSAADADSGTTPAGATGIANMEEAVSASMYSSRNDPIDPETMREIVRVRGVITALVENGVRVDEDMVERAYPRGRRDGPRLRRRRGRRLPRRRPRRPAGCHLDRQVKMHTPRRWLSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.55
4 0.51
5 0.46
6 0.39
7 0.33
8 0.26
9 0.21
10 0.12
11 0.1
12 0.09
13 0.07
14 0.05
15 0.05
16 0.04
17 0.04
18 0.05
19 0.06
20 0.08
21 0.09
22 0.13
23 0.13
24 0.17
25 0.18
26 0.2
27 0.23
28 0.23
29 0.25
30 0.23
31 0.26
32 0.24
33 0.27
34 0.28
35 0.22
36 0.2
37 0.17
38 0.17
39 0.14
40 0.13
41 0.09
42 0.08
43 0.08
44 0.09
45 0.09
46 0.08
47 0.08
48 0.12
49 0.15
50 0.17
51 0.17
52 0.17
53 0.2
54 0.24
55 0.29
56 0.33
57 0.39
58 0.44
59 0.51
60 0.55
61 0.55
62 0.56
63 0.56
64 0.52
65 0.49
66 0.43
67 0.37
68 0.34
69 0.3
70 0.27
71 0.21
72 0.17
73 0.12
74 0.1
75 0.08
76 0.08
77 0.08
78 0.1
79 0.1
80 0.15
81 0.21
82 0.24
83 0.25
84 0.26
85 0.27
86 0.24
87 0.28
88 0.25
89 0.23
90 0.22
91 0.21
92 0.2
93 0.19
94 0.19
95 0.13
96 0.1
97 0.06
98 0.03
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.06
106 0.1
107 0.1
108 0.12
109 0.13
110 0.16
111 0.17
112 0.2
113 0.24
114 0.23
115 0.27
116 0.33
117 0.34
118 0.33
119 0.31
120 0.29
121 0.24
122 0.22
123 0.16
124 0.08
125 0.07
126 0.05
127 0.06
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.07
149 0.09
150 0.11
151 0.16
152 0.22
153 0.25
154 0.32
155 0.32
156 0.33
157 0.32
158 0.3
159 0.25
160 0.2
161 0.17
162 0.1
163 0.1
164 0.07
165 0.06
166 0.05
167 0.05
168 0.04
169 0.03
170 0.02
171 0.03
172 0.03
173 0.03
174 0.05
175 0.06
176 0.07
177 0.08
178 0.09
179 0.11
180 0.14
181 0.15
182 0.14
183 0.15
184 0.14
185 0.14
186 0.13
187 0.1
188 0.07
189 0.07
190 0.07
191 0.08
192 0.11
193 0.13
194 0.16
195 0.2
196 0.26
197 0.32
198 0.35
199 0.4
200 0.43
201 0.49
202 0.51
203 0.55
204 0.53
205 0.5
206 0.47
207 0.43
208 0.4
209 0.36
210 0.33
211 0.29
212 0.3
213 0.33
214 0.32
215 0.3
216 0.28
217 0.25
218 0.22
219 0.19
220 0.15
221 0.09
222 0.09
223 0.08
224 0.06
225 0.05
226 0.05
227 0.04
228 0.04
229 0.06
230 0.08
231 0.09
232 0.1
233 0.1
234 0.12
235 0.12
236 0.15
237 0.15
238 0.13
239 0.12
240 0.11
241 0.12
242 0.11
243 0.11
244 0.08
245 0.06
246 0.05
247 0.05
248 0.05
249 0.04
250 0.04
251 0.04
252 0.05
253 0.05
254 0.06
255 0.06
256 0.05
257 0.05
258 0.06
259 0.05
260 0.04
261 0.04
262 0.04
263 0.08
264 0.09
265 0.09
266 0.11
267 0.13
268 0.14
269 0.15
270 0.16
271 0.16
272 0.22
273 0.22
274 0.23
275 0.24
276 0.25
277 0.25
278 0.25
279 0.23
280 0.19
281 0.21
282 0.19
283 0.17
284 0.17
285 0.17
286 0.16
287 0.16
288 0.14
289 0.11
290 0.12
291 0.11
292 0.09
293 0.08
294 0.08
295 0.07
296 0.06
297 0.07
298 0.07
299 0.08
300 0.1
301 0.11
302 0.11
303 0.12
304 0.14
305 0.19
306 0.22
307 0.25
308 0.33
309 0.39
310 0.46
311 0.56
312 0.65
313 0.7
314 0.77
315 0.84
316 0.85
317 0.88
318 0.9
319 0.91
320 0.92
321 0.92
322 0.92
323 0.94
324 0.95
325 0.95
326 0.97
327 0.96
328 0.96
329 0.96
330 0.95
331 0.93
332 0.92
333 0.92
334 0.9
335 0.88
336 0.85
337 0.84
338 0.76
339 0.7
340 0.67
341 0.65
342 0.65
343 0.66
344 0.64
345 0.63