Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S598

Protein Details
Accession F4S598   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
34-56SNVQNTKKTKTKTKKEKEVMILFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito_nucl 12.999, cyto_nucl 12.833, mito 4.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_75810  -  
Amino Acid Sequences MELRFLSARSKEMRDKDFKQAAKNSSEKISIINSNVQNTKKTKTKTKKEKEVMILFVFLCSKLYKNRGCQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.61
4 0.64
5 0.61
6 0.61
7 0.6
8 0.56
9 0.54
10 0.53
11 0.45
12 0.4
13 0.38
14 0.3
15 0.25
16 0.24
17 0.19
18 0.18
19 0.22
20 0.2
21 0.21
22 0.25
23 0.24
24 0.26
25 0.26
26 0.29
27 0.3
28 0.33
29 0.42
30 0.49
31 0.59
32 0.66
33 0.74
34 0.81
35 0.81
36 0.85
37 0.83
38 0.78
39 0.71
40 0.61
41 0.52
42 0.41
43 0.35
44 0.27
45 0.18
46 0.15
47 0.11
48 0.13
49 0.19
50 0.27
51 0.33