Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RWB0

Protein Details
Accession F4RWB0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
126-145NQRREAKSKKTIRLLLKQLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002773  Deoxyhypusine_synthase  
IPR036982  Deoxyhypusine_synthase_sf  
IPR029035  DHS-like_NAD/FAD-binding_dom  
Gene Ontology GO:0008612  P:peptidyl-lysine modification to peptidyl-hypusine  
KEGG mlr:MELLADRAFT_38133  -  
Pfam View protein in Pfam  
PF01916  DS  
Amino Acid Sequences IAAESILINYQDYNHRLDLNQLISSCQKNGSQATTLYQLIKTINKMVRLQEMLKFSNELSYLSVIVLTAGDIQDDIVKFLGSTYLSSFDSNSRSNSHKSGSIRIENLFVPNVNYYPFEDCFMPILNQRREAKSKKTIRLLLKQLKDLELKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.27
5 0.3
6 0.26
7 0.27
8 0.23
9 0.24
10 0.27
11 0.28
12 0.25
13 0.22
14 0.2
15 0.21
16 0.24
17 0.24
18 0.23
19 0.22
20 0.23
21 0.24
22 0.25
23 0.22
24 0.2
25 0.18
26 0.17
27 0.19
28 0.18
29 0.21
30 0.23
31 0.25
32 0.27
33 0.28
34 0.31
35 0.31
36 0.31
37 0.29
38 0.3
39 0.27
40 0.26
41 0.25
42 0.2
43 0.2
44 0.18
45 0.14
46 0.11
47 0.11
48 0.1
49 0.09
50 0.09
51 0.06
52 0.06
53 0.05
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.05
69 0.05
70 0.06
71 0.08
72 0.09
73 0.09
74 0.1
75 0.11
76 0.14
77 0.15
78 0.16
79 0.17
80 0.19
81 0.22
82 0.24
83 0.24
84 0.26
85 0.27
86 0.32
87 0.35
88 0.36
89 0.35
90 0.33
91 0.33
92 0.28
93 0.28
94 0.22
95 0.16
96 0.14
97 0.13
98 0.13
99 0.12
100 0.13
101 0.13
102 0.16
103 0.16
104 0.17
105 0.16
106 0.16
107 0.17
108 0.17
109 0.17
110 0.19
111 0.28
112 0.29
113 0.36
114 0.4
115 0.45
116 0.52
117 0.56
118 0.59
119 0.6
120 0.67
121 0.68
122 0.73
123 0.75
124 0.75
125 0.78
126 0.8
127 0.8
128 0.76
129 0.73
130 0.67
131 0.63