Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RSQ3

Protein Details
Accession F4RSQ3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPKPTPYKPLNKRKRPATDLQATFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_64770  -  
Amino Acid Sequences MAPKPTPYKPLNKRKRPATDLQATFWKQEDKDAKEMNKVRTQTSDTQALGIGTDGSAAPHEDNVDNFEEHGIDDRNETGYTHNNDHWEDIDEDERIPFNELSEEERRIILELNSNLYQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.9
3 0.86
4 0.84
5 0.82
6 0.81
7 0.73
8 0.68
9 0.66
10 0.57
11 0.51
12 0.44
13 0.39
14 0.28
15 0.34
16 0.38
17 0.34
18 0.4
19 0.45
20 0.44
21 0.49
22 0.55
23 0.52
24 0.5
25 0.47
26 0.41
27 0.39
28 0.42
29 0.39
30 0.36
31 0.36
32 0.3
33 0.29
34 0.27
35 0.23
36 0.19
37 0.13
38 0.09
39 0.04
40 0.04
41 0.04
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.06
50 0.08
51 0.09
52 0.08
53 0.08
54 0.08
55 0.08
56 0.07
57 0.09
58 0.08
59 0.07
60 0.08
61 0.08
62 0.1
63 0.1
64 0.1
65 0.1
66 0.16
67 0.19
68 0.22
69 0.23
70 0.24
71 0.25
72 0.26
73 0.25
74 0.21
75 0.19
76 0.18
77 0.18
78 0.15
79 0.15
80 0.15
81 0.14
82 0.12
83 0.14
84 0.12
85 0.11
86 0.13
87 0.14
88 0.19
89 0.23
90 0.25
91 0.22
92 0.23
93 0.23
94 0.21
95 0.22
96 0.18
97 0.21
98 0.21
99 0.26