Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DPC8

Protein Details
Accession A0A0C4DPC8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSRSRKHKTQARSDPGQRIRRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSSRSRKHKTQARSDPGQRIRRIGLTHWLQVCASFTAGMGPKRSGSRRLPPRTKIPGISVDNIDNCREAQHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.81
4 0.8
5 0.7
6 0.63
7 0.57
8 0.52
9 0.46
10 0.38
11 0.37
12 0.33
13 0.35
14 0.33
15 0.31
16 0.27
17 0.25
18 0.24
19 0.16
20 0.13
21 0.08
22 0.07
23 0.08
24 0.11
25 0.12
26 0.12
27 0.12
28 0.14
29 0.18
30 0.2
31 0.25
32 0.29
33 0.37
34 0.47
35 0.57
36 0.63
37 0.65
38 0.72
39 0.74
40 0.73
41 0.65
42 0.59
43 0.58
44 0.54
45 0.52
46 0.45
47 0.39
48 0.38
49 0.37
50 0.34
51 0.26
52 0.22