Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DTQ7

Protein Details
Accession A0A0C4DTQ7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-99PGFDAERRRARPRPNRRISPDFPELAVNRRIKRTRRTKRTRRTSRMLLQQKDHydrophilic
NLS Segment(s)
PositionSequence
54-90RRRARPRPNRRISPDFPELAVNRRIKRTRRTKRTRRT
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MRMSLDVARLRHQEEDDEDEPDLAAMRISFDFASRFGQEDEENEENEPGFDAERRRARPRPNRRISPDFPELAVNRRIKRTRRTKRTRRTSRMLLQQKDIAKLSRTCHQKEDEEDEEDEPDLEKEKDTEDEEDKEDKKDEKDEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEENEEDKEDQPDLALKRGYRQILPGFAVKRRTRRTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.34
4 0.33
5 0.31
6 0.27
7 0.25
8 0.21
9 0.18
10 0.09
11 0.08
12 0.06
13 0.08
14 0.08
15 0.09
16 0.09
17 0.1
18 0.11
19 0.12
20 0.16
21 0.14
22 0.16
23 0.16
24 0.18
25 0.18
26 0.18
27 0.24
28 0.22
29 0.22
30 0.21
31 0.21
32 0.18
33 0.18
34 0.17
35 0.1
36 0.09
37 0.11
38 0.13
39 0.21
40 0.29
41 0.35
42 0.42
43 0.49
44 0.59
45 0.67
46 0.75
47 0.78
48 0.81
49 0.85
50 0.86
51 0.88
52 0.82
53 0.79
54 0.73
55 0.63
56 0.53
57 0.48
58 0.41
59 0.36
60 0.39
61 0.37
62 0.34
63 0.41
64 0.48
65 0.49
66 0.59
67 0.65
68 0.69
69 0.75
70 0.83
71 0.86
72 0.9
73 0.94
74 0.95
75 0.93
76 0.9
77 0.88
78 0.85
79 0.85
80 0.83
81 0.75
82 0.67
83 0.63
84 0.56
85 0.5
86 0.43
87 0.34
88 0.28
89 0.29
90 0.28
91 0.3
92 0.34
93 0.33
94 0.36
95 0.38
96 0.38
97 0.38
98 0.43
99 0.39
100 0.35
101 0.34
102 0.3
103 0.27
104 0.23
105 0.19
106 0.12
107 0.09
108 0.08
109 0.07
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.13
116 0.14
117 0.15
118 0.18
119 0.21
120 0.21
121 0.2
122 0.21
123 0.2
124 0.19
125 0.21
126 0.21
127 0.22
128 0.25
129 0.27
130 0.29
131 0.29
132 0.28
133 0.25
134 0.22
135 0.18
136 0.15
137 0.11
138 0.09
139 0.07
140 0.06
141 0.07
142 0.07
143 0.07
144 0.07
145 0.08
146 0.07
147 0.07
148 0.08
149 0.07
150 0.07
151 0.08
152 0.07
153 0.07
154 0.08
155 0.07
156 0.07
157 0.08
158 0.07
159 0.07
160 0.08
161 0.07
162 0.07
163 0.08
164 0.07
165 0.07
166 0.08
167 0.07
168 0.07
169 0.08
170 0.07
171 0.07
172 0.08
173 0.07
174 0.07
175 0.08
176 0.07
177 0.07
178 0.08
179 0.07
180 0.07
181 0.08
182 0.07
183 0.07
184 0.08
185 0.07
186 0.07
187 0.08
188 0.07
189 0.07
190 0.08
191 0.07
192 0.07
193 0.08
194 0.07
195 0.07
196 0.08
197 0.07
198 0.07
199 0.08
200 0.07
201 0.07
202 0.08
203 0.07
204 0.07
205 0.08
206 0.07
207 0.07
208 0.08
209 0.07
210 0.07
211 0.08
212 0.07
213 0.07
214 0.08
215 0.07
216 0.07
217 0.08
218 0.07
219 0.07
220 0.08
221 0.07
222 0.07
223 0.08
224 0.07
225 0.07
226 0.08
227 0.07
228 0.07
229 0.08
230 0.07
231 0.07
232 0.08
233 0.07
234 0.08
235 0.09
236 0.09
237 0.09
238 0.12
239 0.13
240 0.14
241 0.17
242 0.16
243 0.15
244 0.15
245 0.2
246 0.19
247 0.22
248 0.25
249 0.23
250 0.29
251 0.36
252 0.38
253 0.34
254 0.39
255 0.39
256 0.41
257 0.43
258 0.44
259 0.41
260 0.43
261 0.51
262 0.51
263 0.56