Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DYN2

Protein Details
Accession A0A0C4DYN2   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
128-156LPRRGSCWPSSRGRCRRCRPTATRWCLRSHydrophilic
NLS Segment(s)
PositionSequence
113-130PRAARRARRARSRATLPR
Subcellular Location(s) mito 19, cyto 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004000  Actin  
IPR043129  ATPase_NBD  
Pfam View protein in Pfam  
PF00022  Actin  
Amino Acid Sequences MAGGRKSRAAAMSPPRQTLVLDNGAYTLKAGLVARGGDDDNDNNNSPDEAAAKKTVEEQPRVVPNCIARDRHRRTYVGSELSKCRDFGEMAFRRPVERGYIVNWEAQREILGPRAARRARRARSRATLPRRGSCWPSSRGRCRRCRPTATRWCLRSLALRATTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.44
4 0.41
5 0.36
6 0.33
7 0.29
8 0.26
9 0.24
10 0.24
11 0.23
12 0.22
13 0.18
14 0.12
15 0.06
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.09
25 0.11
26 0.12
27 0.13
28 0.16
29 0.17
30 0.16
31 0.16
32 0.16
33 0.14
34 0.13
35 0.12
36 0.1
37 0.12
38 0.13
39 0.13
40 0.13
41 0.17
42 0.23
43 0.26
44 0.27
45 0.27
46 0.3
47 0.37
48 0.4
49 0.36
50 0.32
51 0.3
52 0.34
53 0.36
54 0.34
55 0.33
56 0.41
57 0.47
58 0.54
59 0.54
60 0.49
61 0.48
62 0.51
63 0.5
64 0.46
65 0.41
66 0.36
67 0.35
68 0.37
69 0.34
70 0.28
71 0.23
72 0.18
73 0.16
74 0.14
75 0.22
76 0.22
77 0.23
78 0.26
79 0.25
80 0.25
81 0.25
82 0.25
83 0.17
84 0.16
85 0.15
86 0.15
87 0.2
88 0.2
89 0.23
90 0.23
91 0.2
92 0.18
93 0.17
94 0.15
95 0.11
96 0.11
97 0.12
98 0.14
99 0.14
100 0.16
101 0.25
102 0.28
103 0.32
104 0.4
105 0.46
106 0.53
107 0.62
108 0.66
109 0.65
110 0.7
111 0.75
112 0.77
113 0.76
114 0.77
115 0.72
116 0.72
117 0.67
118 0.64
119 0.6
120 0.56
121 0.54
122 0.5
123 0.54
124 0.59
125 0.66
126 0.72
127 0.76
128 0.8
129 0.84
130 0.88
131 0.88
132 0.89
133 0.86
134 0.87
135 0.88
136 0.87
137 0.86
138 0.78
139 0.73
140 0.64
141 0.59
142 0.56
143 0.5
144 0.49
145 0.43