Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EE97

Protein Details
Accession A0A0C4EE97    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-91PSRPKGSKPDRPRTADRPKPQBasic
NLS Segment(s)
PositionSequence
44-106REPASRPKPFPEGSRTRPQPGPRPQPIPSRPKGSKPDRPRTADRPKPQPGPKAPGRGSGRIRR
Subcellular Location(s) extr 22, mito 2, nucl 1, plas 1, pero 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MHFKAAQLVALVALALPAMAAPLDSSSDLTHPGAEALALPVLKREPASRPKPFPEGSRTRPQPGPRPQPIPSRPKGSKPDRPRTADRPKPQPGPKAPGRGSGRIRRSTEETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.05
11 0.06
12 0.07
13 0.07
14 0.08
15 0.1
16 0.1
17 0.1
18 0.09
19 0.09
20 0.07
21 0.07
22 0.06
23 0.05
24 0.06
25 0.06
26 0.05
27 0.06
28 0.07
29 0.07
30 0.08
31 0.09
32 0.15
33 0.24
34 0.32
35 0.38
36 0.42
37 0.45
38 0.5
39 0.5
40 0.47
41 0.46
42 0.45
43 0.45
44 0.5
45 0.49
46 0.48
47 0.51
48 0.52
49 0.53
50 0.55
51 0.59
52 0.55
53 0.57
54 0.57
55 0.63
56 0.66
57 0.64
58 0.59
59 0.59
60 0.56
61 0.59
62 0.64
63 0.63
64 0.66
65 0.68
66 0.74
67 0.74
68 0.78
69 0.78
70 0.78
71 0.8
72 0.8
73 0.78
74 0.77
75 0.76
76 0.79
77 0.78
78 0.78
79 0.74
80 0.73
81 0.72
82 0.72
83 0.66
84 0.66
85 0.65
86 0.64
87 0.65
88 0.66
89 0.67
90 0.66
91 0.68
92 0.64