Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DT79

Protein Details
Accession A0A0C4DT79    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-112LENERDVGKKKRPPRKIQRDATHTHLKBasic
NLS Segment(s)
PositionSequence
93-102GKKKRPPRKI
Subcellular Location(s) extr 14, mito 4, plas 3, mito_nucl 3, nucl 2, pero 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MTWSTDQAQAHKTGRKLVLLLACFLAPRAAAASSLPCLQLTLTKMDSRNRSDQRACRVDLATNHHPKSPTLGGGKTVCEKKACPILENERDVGKKKRPPRKIQRDATHTHLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.36
4 0.34
5 0.35
6 0.3
7 0.3
8 0.23
9 0.21
10 0.18
11 0.18
12 0.14
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.07
19 0.08
20 0.09
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.11
27 0.11
28 0.13
29 0.14
30 0.16
31 0.19
32 0.24
33 0.29
34 0.31
35 0.39
36 0.39
37 0.44
38 0.47
39 0.49
40 0.53
41 0.51
42 0.47
43 0.4
44 0.38
45 0.34
46 0.31
47 0.34
48 0.34
49 0.38
50 0.37
51 0.37
52 0.37
53 0.35
54 0.37
55 0.31
56 0.26
57 0.22
58 0.22
59 0.24
60 0.24
61 0.26
62 0.26
63 0.27
64 0.25
65 0.23
66 0.23
67 0.24
68 0.32
69 0.31
70 0.27
71 0.31
72 0.39
73 0.44
74 0.46
75 0.43
76 0.39
77 0.4
78 0.44
79 0.44
80 0.43
81 0.45
82 0.53
83 0.62
84 0.68
85 0.77
86 0.83
87 0.88
88 0.89
89 0.92
90 0.92
91 0.9
92 0.85