Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EBF3

Protein Details
Accession A0A0C4EBF3    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-34GSAHQRRPVRHHREPNLHSKSBasic
NLS Segment(s)
Subcellular Location(s) nucl 9, plas 8, cyto 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018943  Oligosaccaryltransferase  
IPR036330  Ost4p_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF10215  Ost4  
Amino Acid Sequences MPHDTHPHASREHGSAHQRRPVRHHREPNLHSKSARTDFIPSAAQRPSEKAPSTLHPNPRHIPATMISDNDLYRIAILLGSAAMVLIVVYHFVEVNTAESEQAKTKKAAGSRTGAQPAKAAPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.51
4 0.54
5 0.55
6 0.56
7 0.62
8 0.66
9 0.66
10 0.68
11 0.72
12 0.74
13 0.8
14 0.81
15 0.83
16 0.79
17 0.73
18 0.63
19 0.56
20 0.54
21 0.47
22 0.44
23 0.34
24 0.31
25 0.28
26 0.29
27 0.31
28 0.23
29 0.23
30 0.23
31 0.23
32 0.2
33 0.23
34 0.23
35 0.24
36 0.25
37 0.24
38 0.25
39 0.26
40 0.34
41 0.36
42 0.42
43 0.41
44 0.45
45 0.45
46 0.46
47 0.44
48 0.36
49 0.32
50 0.24
51 0.27
52 0.23
53 0.21
54 0.18
55 0.17
56 0.17
57 0.16
58 0.14
59 0.08
60 0.07
61 0.06
62 0.05
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.03
79 0.03
80 0.05
81 0.05
82 0.07
83 0.08
84 0.08
85 0.09
86 0.1
87 0.12
88 0.17
89 0.2
90 0.21
91 0.21
92 0.25
93 0.29
94 0.32
95 0.38
96 0.37
97 0.4
98 0.43
99 0.49
100 0.54
101 0.51
102 0.47
103 0.43