Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TGX9

Protein Details
Accession A7TGX9   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
11-32PPLPRLKVKKPVIRQETNRCLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG vpo:Kpol_1032p24  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSGKPPVYRLPPLPRLKVKKPVIRQETNRCLVLMSNLLQCWSSNGHMNPVCENLANELKTCTAKNALGNTHKEQKSNINYHAARLYDRVGGKHHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.73
4 0.76
5 0.75
6 0.75
7 0.77
8 0.79
9 0.78
10 0.79
11 0.8
12 0.81
13 0.8
14 0.74
15 0.66
16 0.55
17 0.46
18 0.37
19 0.31
20 0.22
21 0.15
22 0.13
23 0.13
24 0.13
25 0.13
26 0.12
27 0.12
28 0.11
29 0.1
30 0.13
31 0.13
32 0.18
33 0.2
34 0.21
35 0.2
36 0.19
37 0.19
38 0.15
39 0.15
40 0.13
41 0.14
42 0.14
43 0.14
44 0.13
45 0.14
46 0.15
47 0.15
48 0.14
49 0.13
50 0.15
51 0.18
52 0.21
53 0.26
54 0.3
55 0.35
56 0.39
57 0.45
58 0.45
59 0.43
60 0.41
61 0.45
62 0.48
63 0.49
64 0.47
65 0.47
66 0.46
67 0.48
68 0.5
69 0.42
70 0.35
71 0.31
72 0.29
73 0.26
74 0.28
75 0.26