Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4ECI3

Protein Details
Accession A0A0C4ECI3   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-111AEATSTEKKQTKKRKSWGQVLPEPKTHydrophilic
375-395IWLVTRPSRSRRRRQASTSSTHydrophilic
NLS Segment(s)
PositionSequence
94-148KQTKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKR
590-613NKRAGGKRGFDDASAAGGKRRRMG
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR044280  Hac1/HY5  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006986  P:response to unfolded protein  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14710  bZIP_HAC1-like  
Amino Acid Sequences MDSWNATHGSPELKFENSPAESFLSTPGDMYPSLFGASVDATMDPSEMMSPSSLHEDRDQAELDLLSGIAADSASADPATAATPAAEATSTEKKQTKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKRLEVEALEQRNKQLEQKLAQSQDIIMSLFEKIEKMRTDSGVVSRQTPVTLSQELFSSHDALSAAMPSSATSQERKQSLIDELLRSTQSQTTVNPASISPALSPVPEEAPSPAPEQLDATTRATVATSATTSADNMAADVSPDLTQHPAEVLCSDLQCRSAEASQPSQPVAVASPWMTPALVLSWQLTLLLTSTAAIFSAFQRPLTLIAMSLKAGFSLPPTALILNTIIWLVTRPSRSRRRRQASTSSTSTSTSQPTPTSRSSSTSPLPASPRRATATSSASASNPTPSTTLRLRLLRKILTCSPSLARPLSDATLAALRLVQSEERRGVDRVNRGAEGLDAAKSEMGQNPSGTAGGGKEAAGAWLKGVALPSKEVLLTLVWALKVEERMLNIRARDNKLGSGRLPSVAKIDAPLAASASSSSDARTTIVNQKILLTIQHSKANKRAGGKRGFDDASAAGGKRRRMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.31
4 0.28
5 0.28
6 0.26
7 0.26
8 0.24
9 0.24
10 0.26
11 0.21
12 0.19
13 0.19
14 0.17
15 0.17
16 0.16
17 0.17
18 0.15
19 0.12
20 0.13
21 0.12
22 0.11
23 0.1
24 0.11
25 0.1
26 0.09
27 0.08
28 0.09
29 0.09
30 0.09
31 0.07
32 0.07
33 0.08
34 0.07
35 0.08
36 0.08
37 0.08
38 0.1
39 0.18
40 0.18
41 0.2
42 0.22
43 0.25
44 0.26
45 0.29
46 0.28
47 0.21
48 0.22
49 0.19
50 0.17
51 0.14
52 0.12
53 0.08
54 0.07
55 0.06
56 0.04
57 0.04
58 0.03
59 0.04
60 0.05
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.07
67 0.06
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.11
76 0.2
77 0.21
78 0.27
79 0.32
80 0.38
81 0.48
82 0.59
83 0.65
84 0.67
85 0.77
86 0.81
87 0.86
88 0.9
89 0.88
90 0.87
91 0.84
92 0.83
93 0.77
94 0.72
95 0.66
96 0.57
97 0.57
98 0.56
99 0.58
100 0.56
101 0.62
102 0.65
103 0.72
104 0.77
105 0.75
106 0.76
107 0.78
108 0.77
109 0.78
110 0.79
111 0.76
112 0.76
113 0.77
114 0.71
115 0.64
116 0.62
117 0.59
118 0.58
119 0.61
120 0.66
121 0.67
122 0.7
123 0.72
124 0.73
125 0.73
126 0.67
127 0.66
128 0.66
129 0.68
130 0.69
131 0.72
132 0.67
133 0.61
134 0.63
135 0.6
136 0.54
137 0.47
138 0.44
139 0.45
140 0.5
141 0.52
142 0.47
143 0.43
144 0.42
145 0.38
146 0.37
147 0.33
148 0.33
149 0.32
150 0.38
151 0.43
152 0.41
153 0.4
154 0.36
155 0.31
156 0.26
157 0.23
158 0.17
159 0.1
160 0.08
161 0.08
162 0.08
163 0.08
164 0.07
165 0.07
166 0.12
167 0.13
168 0.17
169 0.19
170 0.2
171 0.22
172 0.23
173 0.27
174 0.29
175 0.28
176 0.26
177 0.25
178 0.24
179 0.22
180 0.2
181 0.18
182 0.16
183 0.18
184 0.16
185 0.15
186 0.16
187 0.17
188 0.17
189 0.16
190 0.14
191 0.11
192 0.12
193 0.12
194 0.11
195 0.1
196 0.1
197 0.09
198 0.06
199 0.07
200 0.06
201 0.07
202 0.09
203 0.1
204 0.12
205 0.15
206 0.2
207 0.22
208 0.23
209 0.22
210 0.22
211 0.23
212 0.26
213 0.26
214 0.21
215 0.21
216 0.22
217 0.22
218 0.2
219 0.19
220 0.15
221 0.14
222 0.14
223 0.14
224 0.18
225 0.18
226 0.18
227 0.17
228 0.15
229 0.16
230 0.15
231 0.16
232 0.1
233 0.11
234 0.11
235 0.1
236 0.1
237 0.09
238 0.1
239 0.09
240 0.1
241 0.09
242 0.11
243 0.13
244 0.14
245 0.14
246 0.13
247 0.13
248 0.14
249 0.13
250 0.13
251 0.14
252 0.14
253 0.13
254 0.12
255 0.12
256 0.11
257 0.1
258 0.08
259 0.07
260 0.05
261 0.06
262 0.06
263 0.06
264 0.06
265 0.07
266 0.07
267 0.06
268 0.06
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.04
275 0.05
276 0.05
277 0.06
278 0.06
279 0.06
280 0.06
281 0.06
282 0.06
283 0.06
284 0.06
285 0.06
286 0.06
287 0.07
288 0.07
289 0.08
290 0.08
291 0.09
292 0.09
293 0.09
294 0.12
295 0.14
296 0.17
297 0.18
298 0.19
299 0.19
300 0.17
301 0.16
302 0.13
303 0.11
304 0.08
305 0.06
306 0.06
307 0.06
308 0.07
309 0.07
310 0.06
311 0.05
312 0.05
313 0.05
314 0.05
315 0.06
316 0.06
317 0.06
318 0.06
319 0.06
320 0.06
321 0.05
322 0.04
323 0.04
324 0.04
325 0.04
326 0.04
327 0.04
328 0.04
329 0.04
330 0.04
331 0.05
332 0.11
333 0.11
334 0.11
335 0.11
336 0.12
337 0.13
338 0.13
339 0.12
340 0.07
341 0.08
342 0.09
343 0.09
344 0.09
345 0.08
346 0.07
347 0.07
348 0.06
349 0.06
350 0.07
351 0.07
352 0.07
353 0.08
354 0.08
355 0.08
356 0.08
357 0.08
358 0.06
359 0.07
360 0.06
361 0.05
362 0.05
363 0.05
364 0.06
365 0.09
366 0.13
367 0.16
368 0.25
369 0.36
370 0.46
371 0.56
372 0.66
373 0.72
374 0.76
375 0.8
376 0.82
377 0.8
378 0.77
379 0.71
380 0.63
381 0.54
382 0.48
383 0.42
384 0.33
385 0.29
386 0.23
387 0.21
388 0.21
389 0.22
390 0.26
391 0.27
392 0.3
393 0.28
394 0.3
395 0.3
396 0.33
397 0.32
398 0.32
399 0.3
400 0.29
401 0.34
402 0.35
403 0.39
404 0.36
405 0.37
406 0.36
407 0.36
408 0.34
409 0.33
410 0.33
411 0.27
412 0.27
413 0.24
414 0.21
415 0.22
416 0.21
417 0.19
418 0.15
419 0.14
420 0.14
421 0.14
422 0.19
423 0.2
424 0.24
425 0.26
426 0.33
427 0.35
428 0.4
429 0.45
430 0.45
431 0.44
432 0.46
433 0.46
434 0.42
435 0.4
436 0.36
437 0.33
438 0.31
439 0.32
440 0.27
441 0.22
442 0.2
443 0.22
444 0.2
445 0.18
446 0.15
447 0.12
448 0.13
449 0.13
450 0.11
451 0.1
452 0.09
453 0.09
454 0.1
455 0.13
456 0.13
457 0.17
458 0.2
459 0.21
460 0.24
461 0.24
462 0.28
463 0.31
464 0.36
465 0.37
466 0.37
467 0.36
468 0.34
469 0.33
470 0.28
471 0.24
472 0.17
473 0.13
474 0.1
475 0.1
476 0.09
477 0.09
478 0.11
479 0.13
480 0.15
481 0.16
482 0.16
483 0.16
484 0.17
485 0.16
486 0.15
487 0.11
488 0.08
489 0.08
490 0.09
491 0.08
492 0.08
493 0.07
494 0.09
495 0.1
496 0.09
497 0.08
498 0.09
499 0.09
500 0.09
501 0.11
502 0.12
503 0.12
504 0.14
505 0.14
506 0.14
507 0.14
508 0.13
509 0.13
510 0.1
511 0.1
512 0.09
513 0.11
514 0.1
515 0.1
516 0.11
517 0.12
518 0.13
519 0.14
520 0.15
521 0.16
522 0.2
523 0.23
524 0.26
525 0.26
526 0.32
527 0.38
528 0.42
529 0.46
530 0.44
531 0.48
532 0.48
533 0.5
534 0.44
535 0.43
536 0.39
537 0.37
538 0.36
539 0.3
540 0.29
541 0.26
542 0.25
543 0.2
544 0.19
545 0.16
546 0.16
547 0.16
548 0.13
549 0.12
550 0.12
551 0.1
552 0.11
553 0.11
554 0.1
555 0.11
556 0.11
557 0.11
558 0.12
559 0.14
560 0.17
561 0.24
562 0.3
563 0.31
564 0.31
565 0.32
566 0.33
567 0.32
568 0.29
569 0.26
570 0.27
571 0.29
572 0.36
573 0.38
574 0.42
575 0.48
576 0.54
577 0.52
578 0.54
579 0.59
580 0.61
581 0.67
582 0.67
583 0.64
584 0.64
585 0.6
586 0.51
587 0.46
588 0.37
589 0.32
590 0.29
591 0.25
592 0.23
593 0.26