Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E3K2

Protein Details
Accession A0A0C4E3K2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MNKKEEKKKNKEWSSPLMDQHydrophilic
87-112RWLLPTPPQRQGKNKKKDQNPSTGSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 10.833, nucl 8, cyto_nucl 7.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MNKKEEKKKNKEWSSPLMDQSRAPEYIPGIALFTHIPLCFPPPSSLDPNLRTMHAISRRATPMGPHIWFFPLLFSWFLFTSRVLPCRWLLPTPPQRQGKNKKKDQNPSTGSGHTKDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.73
4 0.66
5 0.57
6 0.49
7 0.46
8 0.4
9 0.32
10 0.27
11 0.22
12 0.18
13 0.19
14 0.18
15 0.14
16 0.11
17 0.1
18 0.11
19 0.09
20 0.09
21 0.09
22 0.08
23 0.09
24 0.08
25 0.12
26 0.11
27 0.13
28 0.14
29 0.15
30 0.19
31 0.23
32 0.27
33 0.29
34 0.3
35 0.33
36 0.32
37 0.3
38 0.26
39 0.23
40 0.25
41 0.25
42 0.27
43 0.23
44 0.26
45 0.27
46 0.27
47 0.26
48 0.2
49 0.2
50 0.21
51 0.21
52 0.17
53 0.17
54 0.18
55 0.18
56 0.17
57 0.13
58 0.09
59 0.09
60 0.1
61 0.09
62 0.1
63 0.1
64 0.11
65 0.11
66 0.1
67 0.14
68 0.16
69 0.19
70 0.17
71 0.19
72 0.19
73 0.22
74 0.24
75 0.22
76 0.22
77 0.31
78 0.4
79 0.45
80 0.54
81 0.58
82 0.61
83 0.7
84 0.78
85 0.78
86 0.78
87 0.81
88 0.82
89 0.85
90 0.9
91 0.86
92 0.86
93 0.8
94 0.76
95 0.7
96 0.66
97 0.6