Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DZY8

Protein Details
Accession A0A0C4DZY8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
91-121AITKRCEHCKVVRRKRGKRHRGWRYVICSANHydrophilic
NLS Segment(s)
PositionSequence
103-112RRKRGKRHRG
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASISILSRAARASSLVASMRGLSINPQQQQHAFQQTRLLSRSIFGSMAPRARTCGGALPLVASVSTRPVVAAGRAAAVQQQTRGMKLRSAITKRCEHCKVVRRKRGKRHRGWRYVICSANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.13
8 0.12
9 0.11
10 0.11
11 0.17
12 0.23
13 0.26
14 0.27
15 0.29
16 0.3
17 0.34
18 0.36
19 0.39
20 0.34
21 0.31
22 0.36
23 0.36
24 0.38
25 0.36
26 0.32
27 0.21
28 0.21
29 0.22
30 0.17
31 0.14
32 0.11
33 0.12
34 0.14
35 0.18
36 0.19
37 0.17
38 0.18
39 0.19
40 0.19
41 0.16
42 0.17
43 0.15
44 0.14
45 0.14
46 0.12
47 0.11
48 0.1
49 0.1
50 0.06
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.08
68 0.13
69 0.13
70 0.15
71 0.19
72 0.18
73 0.19
74 0.21
75 0.26
76 0.29
77 0.35
78 0.39
79 0.41
80 0.49
81 0.51
82 0.57
83 0.55
84 0.51
85 0.55
86 0.59
87 0.64
88 0.67
89 0.74
90 0.77
91 0.83
92 0.89
93 0.91
94 0.92
95 0.92
96 0.92
97 0.93
98 0.93
99 0.91
100 0.89
101 0.86
102 0.83
103 0.76
104 0.69
105 0.66
106 0.63
107 0.65
108 0.65
109 0.65