Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DYY3

Protein Details
Accession A0A0C4DYY3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-71ISVDANGRRRRRRKPQDPEVKDGIBasic
NLS Segment(s)
PositionSequence
55-62RRRRRRKP
Subcellular Location(s) mito 7extr 7E.R. 7, plas 5
Family & Domain DBs
Amino Acid Sequences MAPPHLHPRSRMTSSLFMTTVFASFFVVALPHVLPCPAPRKAFLDGEISVDANGRRRRRRKPQDPEVKDGIVQFDAMNGPVESPSAHPAGATKRECPVPKPGGVVGELLGFRKPSPNEQEQNARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.41
4 0.33
5 0.3
6 0.27
7 0.21
8 0.14
9 0.12
10 0.09
11 0.08
12 0.08
13 0.06
14 0.06
15 0.05
16 0.07
17 0.07
18 0.06
19 0.06
20 0.07
21 0.07
22 0.1
23 0.16
24 0.19
25 0.2
26 0.22
27 0.25
28 0.29
29 0.3
30 0.29
31 0.27
32 0.23
33 0.24
34 0.22
35 0.19
36 0.14
37 0.14
38 0.13
39 0.16
40 0.22
41 0.26
42 0.35
43 0.43
44 0.53
45 0.63
46 0.74
47 0.78
48 0.82
49 0.86
50 0.88
51 0.86
52 0.82
53 0.74
54 0.63
55 0.53
56 0.43
57 0.33
58 0.22
59 0.17
60 0.1
61 0.08
62 0.07
63 0.07
64 0.08
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.09
72 0.09
73 0.09
74 0.08
75 0.11
76 0.16
77 0.24
78 0.25
79 0.24
80 0.27
81 0.33
82 0.35
83 0.36
84 0.4
85 0.37
86 0.37
87 0.39
88 0.36
89 0.32
90 0.31
91 0.29
92 0.2
93 0.18
94 0.16
95 0.14
96 0.13
97 0.12
98 0.12
99 0.18
100 0.2
101 0.25
102 0.33
103 0.42
104 0.46
105 0.52