Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E9I8

Protein Details
Accession A0A0C4E9I8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-58AAAGGNNRRKRKRNPYSHGCVANHydrophilic
NLS Segment(s)
PositionSequence
42-48NRRKRKR
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
Gene Ontology GO:0016740  F:transferase activity  
Amino Acid Sequences MGQLKRPPAPAPPRALTWGRLLGVDAFIETATGRGAAAGGNNRRKRKRNPYSHGCVANCRDFWCDPAPVFGRRETGAGMLGGETVNWTEVYESPAGMGIGAATRRSGAARRGGYEAVAADEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.45
4 0.41
5 0.38
6 0.31
7 0.28
8 0.26
9 0.21
10 0.19
11 0.16
12 0.11
13 0.08
14 0.07
15 0.07
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.06
25 0.12
26 0.19
27 0.29
28 0.35
29 0.44
30 0.51
31 0.59
32 0.67
33 0.72
34 0.76
35 0.78
36 0.81
37 0.82
38 0.83
39 0.82
40 0.78
41 0.67
42 0.61
43 0.53
44 0.47
45 0.38
46 0.31
47 0.27
48 0.21
49 0.23
50 0.2
51 0.18
52 0.14
53 0.18
54 0.2
55 0.2
56 0.21
57 0.19
58 0.19
59 0.18
60 0.19
61 0.15
62 0.13
63 0.11
64 0.1
65 0.09
66 0.07
67 0.06
68 0.06
69 0.05
70 0.04
71 0.04
72 0.05
73 0.04
74 0.05
75 0.05
76 0.06
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.08
84 0.07
85 0.04
86 0.06
87 0.07
88 0.08
89 0.07
90 0.07
91 0.08
92 0.11
93 0.14
94 0.17
95 0.25
96 0.28
97 0.3
98 0.34
99 0.34
100 0.32
101 0.3
102 0.25
103 0.19