Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DQF5

Protein Details
Accession A0A0C4DQF5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-117IVPPKFRPQPNYKPPKRYRPPREPASSPSHydrophilic
NLS Segment(s)
PositionSequence
102-108PPKRYRP
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR020592  Ribosomal_S16_CS  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
PROSITE View protein in PROSITE  
PS00732  RIBOSOMAL_S16  
Amino Acid Sequences MVVKMRLARFGRTNAPFFNIVIAQARTARNSKPMEVIGTYDPIPKTDSYDKSRKLHKDIQLDMTRAKYWIGVGAQPTDTVWRLLSMVGIVPPKFRPQPNYKPPKRYRPPREPASSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.39
4 0.34
5 0.32
6 0.23
7 0.19
8 0.19
9 0.18
10 0.16
11 0.19
12 0.19
13 0.2
14 0.22
15 0.23
16 0.26
17 0.29
18 0.29
19 0.28
20 0.28
21 0.27
22 0.25
23 0.26
24 0.2
25 0.19
26 0.18
27 0.18
28 0.17
29 0.15
30 0.16
31 0.14
32 0.18
33 0.22
34 0.28
35 0.31
36 0.39
37 0.44
38 0.47
39 0.54
40 0.53
41 0.54
42 0.55
43 0.56
44 0.55
45 0.52
46 0.55
47 0.51
48 0.48
49 0.42
50 0.36
51 0.3
52 0.23
53 0.2
54 0.13
55 0.09
56 0.1
57 0.1
58 0.1
59 0.11
60 0.12
61 0.12
62 0.12
63 0.12
64 0.11
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.11
76 0.11
77 0.13
78 0.14
79 0.2
80 0.25
81 0.28
82 0.34
83 0.41
84 0.52
85 0.61
86 0.71
87 0.74
88 0.8
89 0.85
90 0.88
91 0.9
92 0.9
93 0.9
94 0.9
95 0.91
96 0.9
97 0.89