FuNGI

Q8TGH6

Protein Details

Accession

Q8TGH6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
115-135	LDTTKNSKPNQQQQQNTQKGA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 20, golg 4, E.R. 3

Family & Domain DBs

InterPro	View protein in InterPro IPR000407 GDA1_CD39_NTPase
Gene Ontology	GO:0005794 C:Golgi apparatus GO:0000139 C:Golgi membrane GO:0016020 C:membrane GO:0004382 F:GDP phosphatase activity GO:0045134 F:UDP phosphatase activity GO:0036187 P:cell growth mode switching, budding to filamentous GO:0036244 P:cellular response to neutral pH GO:0030447 P:filamentous growth GO:0036178 P:filamentous growth of a population of unicellular organisms in response to neutral pH GO:0009272 P:fungal-type cell wall biogenesis GO:0009134 P:nucleoside diphosphate catabolic process GO:0006486 P:protein glycosylation GO:0006487 P:protein N-linked glycosylation GO:0006493 P:protein O-linked glycosylation
KEGG	cal:CAALFM_C306120CA -
Pfam	View protein in Pfam PF01150 GDA1_CD39
PROSITE	View protein in PROSITE PS01238 GDA1_CD39_NTPASE
CDD	cd00012 NBD_sugar-kinase_HSP70_actin

Amino Acid Sequences

MINPRNLRLIIAVIGLVGIFAFFASSQHSLVDRTALQVNKPAADSPHVPPPAAAAAPVSPPPPSQQQKQQEGSQKQLNDENSDEKNTLQGTSYSGTKPPYEKVDGKSNKILADKLDTTKNSKPNQQQQQNTQKGASEEKSAQNKITTPEEVSMDNGKCNDIDYVVMIDAGSTGSRVHVYEFNTCVKPPQLLSEEFEMLKPGLSSFDTDTVGAAKSLDPLLEVALKKVPKNKQSCTPVAVKATAGLRLLGETKSKAILDEVRSHLEKDYPFAVVSEDGISIMDGKDEGVYAWVTANYLLGNIGGKEKLPTAAVFDLGGGSTQIVFEPDYKVDEVPVDGETKYHFTFGDNQYTLYQFSHLGYGLMQGRNKVNQLVLKNKLSELNLQKYTKKEVKGAKATVDVSNPCIPPGVVAKDVQVELGEDEFYVVNMKGPSSKDSTVAGGSQCRYLAEKVLNKDAECTSKPCSFNGVHQPSLTRTFNKNSDMYVFSYFYDRTNPIGMPSSFSVEELKDLSKLVCQGETFWKDILLDDHVKNLNEEPQWCLDLSFITAMLHTGYDIPLHRELKTAKTIDNNELGWCLGASLPLLDKNNAKWTCRIDKTD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.09
3	0.08
4	0.05
5	0.03
6	0.03
7	0.02
8	0.03
9	0.03
10	0.04
11	0.09
12	0.1
13	0.11
14	0.13
15	0.14
16	0.16
17	0.16
18	0.2
19	0.16
20	0.18
21	0.23
22	0.24
23	0.24
24	0.29
25	0.31
26	0.29
27	0.29
28	0.28
29	0.25
30	0.28
31	0.31
32	0.28
33	0.35
34	0.34
35	0.33
36	0.31
37	0.31
38	0.3
39	0.26
40	0.22
41	0.14
42	0.15
43	0.17
44	0.19
45	0.16
46	0.14
47	0.15
48	0.19
49	0.27
50	0.32
51	0.37
52	0.45
53	0.55
54	0.63
55	0.67
56	0.7
57	0.71
58	0.7
59	0.7
60	0.66
61	0.58
62	0.52
63	0.53
64	0.48
65	0.42
66	0.4
67	0.39
68	0.35
69	0.36
70	0.33
71	0.27
72	0.28
73	0.24
74	0.22
75	0.18
76	0.15
77	0.15
78	0.17
79	0.2
80	0.19
81	0.21
82	0.22
83	0.24
84	0.26
85	0.27
86	0.32
87	0.35
88	0.39
89	0.41
90	0.5
91	0.52
92	0.55
93	0.57
94	0.53
95	0.5
96	0.46
97	0.43
98	0.34
99	0.35
100	0.34
101	0.31
102	0.35
103	0.33
104	0.37
105	0.43
106	0.49
107	0.47
108	0.52
109	0.58
110	0.62
111	0.7
112	0.74
113	0.74
114	0.76
115	0.83
116	0.81
117	0.74
118	0.64
119	0.55
120	0.49
121	0.47
122	0.38
123	0.32
124	0.29
125	0.34
126	0.4
127	0.4
128	0.39
129	0.35
130	0.36
131	0.34
132	0.34
133	0.29
134	0.24
135	0.24
136	0.24
137	0.23
138	0.23
139	0.25
140	0.21
141	0.21
142	0.2
143	0.18
144	0.17
145	0.17
146	0.15
147	0.09
148	0.09
149	0.08
150	0.09
151	0.08
152	0.08
153	0.07
154	0.06
155	0.06
156	0.06
157	0.05
158	0.04
159	0.04
160	0.05
161	0.06
162	0.06
163	0.08
164	0.12
165	0.14
166	0.18
167	0.21
168	0.24
169	0.25
170	0.25
171	0.25
172	0.22
173	0.22
174	0.18
175	0.21
176	0.21
177	0.21
178	0.24
179	0.25
180	0.25
181	0.24
182	0.23
183	0.19
184	0.15
185	0.14
186	0.11
187	0.08
188	0.07
189	0.08
190	0.09
191	0.09
192	0.12
193	0.12
194	0.12
195	0.12
196	0.12
197	0.11
198	0.1
199	0.09
200	0.06
201	0.07
202	0.07
203	0.07
204	0.06
205	0.06
206	0.07
207	0.1
208	0.1
209	0.1
210	0.14
211	0.16
212	0.17
213	0.25
214	0.31
215	0.35
216	0.42
217	0.45
218	0.5
219	0.56
220	0.57
221	0.54
222	0.51
223	0.47
224	0.42
225	0.38
226	0.29
227	0.25
228	0.22
229	0.2
230	0.15
231	0.12
232	0.1
233	0.1
234	0.11
235	0.1
236	0.1
237	0.09
238	0.09
239	0.11
240	0.11
241	0.1
242	0.1
243	0.14
244	0.16
245	0.2
246	0.22
247	0.24
248	0.24
249	0.25
250	0.24
251	0.23
252	0.2
253	0.16
254	0.15
255	0.13
256	0.12
257	0.12
258	0.12
259	0.08
260	0.09
261	0.07
262	0.06
263	0.06
264	0.05
265	0.05
266	0.05
267	0.05
268	0.04
269	0.03
270	0.03
271	0.03
272	0.03
273	0.03
274	0.04
275	0.04
276	0.04
277	0.05
278	0.04
279	0.05
280	0.05
281	0.05
282	0.04
283	0.04
284	0.04
285	0.03
286	0.04
287	0.04
288	0.05
289	0.05
290	0.05
291	0.06
292	0.06
293	0.06
294	0.07
295	0.07
296	0.09
297	0.09
298	0.09
299	0.08
300	0.08
301	0.07
302	0.07
303	0.06
304	0.04
305	0.03
306	0.03
307	0.03
308	0.03
309	0.04
310	0.04
311	0.05
312	0.07
313	0.07
314	0.09
315	0.09
316	0.09
317	0.09
318	0.09
319	0.08
320	0.07
321	0.08
322	0.08
323	0.07
324	0.07
325	0.08
326	0.11
327	0.11
328	0.1
329	0.1
330	0.1
331	0.18
332	0.2
333	0.28
334	0.25
335	0.26
336	0.26
337	0.27
338	0.26
339	0.19
340	0.17
341	0.09
342	0.1
343	0.1
344	0.09
345	0.08
346	0.07
347	0.1
348	0.13
349	0.15
350	0.15
351	0.16
352	0.18
353	0.19
354	0.2
355	0.18
356	0.16
357	0.18
358	0.22
359	0.27
360	0.31
361	0.32
362	0.32
363	0.32
364	0.32
365	0.29
366	0.32
367	0.32
368	0.33
369	0.37
370	0.39
371	0.41
372	0.4
373	0.46
374	0.45
375	0.4
376	0.4
377	0.42
378	0.49
379	0.54
380	0.53
381	0.48
382	0.46
383	0.46
384	0.4
385	0.36
386	0.28
387	0.24
388	0.27
389	0.24
390	0.21
391	0.19
392	0.17
393	0.15
394	0.19
395	0.18
396	0.14
397	0.15
398	0.16
399	0.17
400	0.17
401	0.16
402	0.12
403	0.09
404	0.08
405	0.08
406	0.07
407	0.05
408	0.06
409	0.06
410	0.06
411	0.07
412	0.06
413	0.08
414	0.09
415	0.09
416	0.12
417	0.14
418	0.17
419	0.2
420	0.21
421	0.2
422	0.22
423	0.23
424	0.2
425	0.21
426	0.2
427	0.18
428	0.18
429	0.18
430	0.17
431	0.16
432	0.17
433	0.16
434	0.19
435	0.22
436	0.27
437	0.29
438	0.36
439	0.38
440	0.35
441	0.38
442	0.35
443	0.34
444	0.31
445	0.3
446	0.28
447	0.33
448	0.34
449	0.31
450	0.34
451	0.3
452	0.35
453	0.43
454	0.44
455	0.39
456	0.39
457	0.4
458	0.38
459	0.44
460	0.39
461	0.33
462	0.32
463	0.36
464	0.4
465	0.43
466	0.41
467	0.36
468	0.37
469	0.35
470	0.33
471	0.3
472	0.26
473	0.22
474	0.24
475	0.23
476	0.2
477	0.22
478	0.21
479	0.19
480	0.21
481	0.21
482	0.2
483	0.26
484	0.25
485	0.24
486	0.24
487	0.26
488	0.23
489	0.24
490	0.24
491	0.17
492	0.19
493	0.17
494	0.17
495	0.13
496	0.14
497	0.14
498	0.14
499	0.17
500	0.17
501	0.17
502	0.16
503	0.19
504	0.28
505	0.3
506	0.3
507	0.27
508	0.26
509	0.24
510	0.25
511	0.24
512	0.2
513	0.23
514	0.21
515	0.27
516	0.29
517	0.3
518	0.3
519	0.3
520	0.3
521	0.28
522	0.29
523	0.27
524	0.27
525	0.28
526	0.26
527	0.25
528	0.19
529	0.16
530	0.16
531	0.13
532	0.1
533	0.09
534	0.09
535	0.09
536	0.09
537	0.08
538	0.07
539	0.07
540	0.07
541	0.1
542	0.12
543	0.16
544	0.23
545	0.25
546	0.25
547	0.3
548	0.32
549	0.35
550	0.42
551	0.4
552	0.37
553	0.44
554	0.48
555	0.48
556	0.5
557	0.45
558	0.38
559	0.36
560	0.32
561	0.24
562	0.19
563	0.14
564	0.09
565	0.09
566	0.08
567	0.08
568	0.1
569	0.15
570	0.18
571	0.2
572	0.23
573	0.27
574	0.36
575	0.39
576	0.4
577	0.41
578	0.47
579	0.54

Q8TGH6

3D AlphaFold-predicted Structure Viewer